HIPK1 (NM_198268) Human Tagged ORF Clone

CAT#: RC216108

HIPK1 (Myc-DDK-tagged)-Human homeodomain interacting protein kinase 1 (HIPK1), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,844.00


Availability*
6 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name HIPK1 (NM_198268) Human Tagged ORF Clone
Symbol HIPK1
Synonyms Myak; Nbak2
Vector pCMV6-Entry
Sequence Data
>RC216108 representing NM_198268
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATCACAGCTGCAAGTGTTTTCGCCCCCATCAGTGTCGTCGAGTGCCTTCTGCAGTGCGAAGAAAC
TGAAAATAGAGCCCTCTGGCTGGGATGTTTCAGGACAGAGTAGCAACGACAAATATTATACCCACAGCAA
AACCCTCCCAGCCACACAAGGGCAAGCCAACTCCTCTCACCAGGTAGCAAATTTCAACATCCCTGCTTAC
GACCAGGGCCTCCTCCTCCCAGCTCCTGCAGTGGAGCATATTGTTGTAACAGCCGCTGATAGCTCGGGCA
GTGCTGCTACATCAACCTTCCAAAGCAGCCAGACCCTGACTCACAGAAGCAACGTTTCTTTGCTTGAGCC
ATATCAAAAATGTGGATTGAAACGAAAAAGTGAGGAAGTTGACAGCAACGGTAGTGTGCAGATCATAGAA
GAACATCCCCCTCTCATGCTGCAAAACAGGACTGTGGTGGGTGCTGCTGCCACAACCACCACTGTGACCA
CAAAGAGTAGCAGTTCCAGCGGAGAAGGGGATTACCAGCTGGTCCAGCATGAGATCCTTTGCTCTATGAC
CAATAGCTATGAAGTCTTGGAGTTCCTAGGCCGGGGGACATTTGGACAGGTGGCTAAGTGCTGGAAGAGG
AGCACCAAGGAAATTGTGGCTATTAAAATCTTGAAGAACCACCCCTCCTATGCCAGACAAGGACAGATTG
AAGTGAGCATCCTTTCCCGCCTAAGCAGTGAAAATGCTGATGAGTATAATTTTGTCCGTTCATACGAGTG
CTTTCAGCATAAGAATCACACCTGCCTTGTTTTTGAAATGTTGGAGCAGAACTTATATGATTTTCTAAAG
CAAAACAAATTTAGCCCACTGCCACTCAAGTACATCAGACCAATCTTGCAGCAGGTGGCCACAGCCTTGA
TGAAGCTCAAGAGTCTTGGTCTGATCCACGCTGACCTTAAGCCTGAAAACATCATGCTGGTTGATCCAGT
TCGCCAGCCCTACCGAGTGAAGGTCATTGACTTTGGTTCTGCTAGTCACGTTTCCAAAGCTGTGTGCTCA
ACCTACTTACAGTCACGTTACTACAGAGCTCCTGAAATTATTCTTGGGTTACCATTTTGTGAAGCTATTG
ATATGTGGTCACTGGGCTGTGTGATAGCTGAGCTGTTCCTGGGATGGCCTCTTTATCCTGGTGCTTCAGA
ATATGATCAGATTCGTTATATTTCACAAACACAAGGCTTGCCAGCTGAATATCTTCTCAGTGCCGGAACA
AAAACAACCAGGTTTTTCAACAGAGATCCTAATTTGGGGTACCCACTGTGGAGGCTTAAGACACCTGAAG
AACATGAACTGGAGACTGGAATAAAATCAAAAGAAGCTCGGAAGTACATTTTTAATTGCTTAGATGACAT
GGCTCAGGTGAATATGTCTACAGACCTGGAGGGAACAGACATGTTGGCAGAGAAGGCAGACCGAAGAGAA
TACATTGATCTGTTAAAGAAAATGCTCACAATTGATGCAGATAAGAGAATTACCCCTCTAAAAACTCTTA
ACCATCAGTTTGTGACAATGACTCACCTTTTGGATTTTCCACATAGCAATCATGTTAAGTCTTGTTTTCA
GAACATGGAGATCTGCAAGCGGAGGGTTCACATGTATGATACAGTGAGTCAGATCAAGAGTCCCTTCACT
ACACATGTTGCCCCAAATACAAGCACAAATCTAACCATGAGCTTCAGCAATCAGCTCAATACAGTGCACA
ATCAGGCCAGTGTTCTAGCTTCCAGTTCTACTGCAGCAGCTGCTACTCTTTCTCTGGCTAATTCAGATGT
CTCACTACTAAACTACCAGTCAGCTTTGTACCCATCATCTGCTGCACCAGTTCCTGGAGTTGCCCAGCAG
GGTGTTTCCTTGCAGCCTGGAACCACCCAGATTTGCACTCAGACAGATCCATTCCAACAGACATTTATAG
TATGTCCACCTGCGTTTCAAACTGGACTACAAGCAACAACAAAGCATTCTGGATTCCCTGTGAGGATGGA
TAATGCTGTACCGATTGTACCCCAGGCACCAGCTGCTCAGCCACTACAGATTCAGTCAGGAGTTCTCACG
CAGGGAAGCTGTACACCACTAATGGTAGCAACTCTCCACCCTCAAGTAGCCACCATCACACCGCAGTATG
CGGTGCCCTTTACTCTGAGCTGCGCAGCCGGCCGGCCGGCGCTGGTTGAACAGACTGCCGCTGTACTGCA
GGCGTGGCCTGGAGGGACTCAGCAAATTCTCCTGCCTTCAACTTGGCAACAGTTGCCTGGGGTAGCTCTA
CACAACTCTGTCCAGCCCACAGCAATGATTCCAGAGGCCATGGGGAGTGGACAGCAGCTAGCTGACTGGA
GGAATGCCCACTCTCATGGCAACCAGTACAGCACTATCATGCAGCAGCCATCCTTGCTGACTAACCATGT
GACATTGGCCACTGCTCAGCCTCTGAATGTTGGTGTTGCCCATGTTGTCAGACAACAACAATCCAGTTCC
CTCCCTTCGAAGAAGAATAAGCAGTCAGCTCCAGTCTCTTCCAAGTCCTCTCTAGATGTTCTGCCTTCCC
AAGTCTATTCTCTGGTTGGGAGCAGTCCCCTCCGCACCACATCTTCTTATAATTCCTTGGTCCCTGTCCA
AGATCAGCATCAGCCCATCATCATTCCAGATACTCCCAGCCCTCCTGTGAGTGTCATCACTATCCGAAGT
GACACTGATGAGGAAGAGGACAACAAATACAAGCCCAGTAGCTCTGGACTGAAGCCAAGGTCTAATGTCA
TCAGTTATGTCACTGTCAATGATTCTCCAGACTCTGACTCTTCTTTGAGCAGCCCTTATTCCACTGATAC
CCTGAGTGCTCTCCGAGGCAATAGTGGATCCGTTTTGGAGGGGCCTGGCAGAGTTGTGGCAGATGGCACT
GGCACCCGCACTATCATTGTGCCTCCACTGAAAACTCAGCTTGGTGACTGCACTGTAGCAACCCAGGCCT
CAGGTCTCCTGAGCAATAAGACTAAGCCAGTCGCTTCAGTGAGTGGGCAGTCATCTGGATGCTGTATCAC
CCCCACAGGGTATCGAGCTCAACGCGGGGGGACCAGTGCAGCACAACCACTCAATCTTAGCCAGAACCAG
CAGTCATCGGCGGCTCCAACCTCACAGGAGAGAAGCAGCAACCCAGCCCCCCGCAGGCAGCAGGCGTTTG
TGGCCCCTCTCTCCCAAGCCCCCTACACCTTCCAGCATGGCAGCCCGCTACACTCGACAGGGCACCCACA
CCTTGCCCCGGCCCCTGCTCACCTGCCAAGCCAGGCTCATCTGTATACGTATGCTGCCCCGACTTCTGCT
GCTGCACTGGGCTCAACCAGCTCCATTGCTCATCTTTTCTCCCCACAGGGTTCCTCAAGGCATGCTGCAG
CCTATACCACTCACCCTAGCACTTTGGTGCACCAGGTCCCTGTCAGTGTTGGGCCCAGCCTCCTCACTTC
TGCCAGCGTGGCCCCTGCTCAGTACCAACACCAGTTTGCCACCCAATCCTACATTGGGTCTTCCCGAGGC
TCAACAATTTACACTGGATACCCGCTGAGTCCTACCAAGATCAGCCAGTATTCCTACTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216108 representing NM_198268
Red=Cloning site Green=Tags(s)

MASQLQVFSPPSVSSSAFCSAKKLKIEPSGWDVSGQSSNDKYYTHSKTLPATQGQANSSHQVANFNIPAY
DQGLLLPAPAVEHIVVTAADSSGSAATSTFQSSQTLTHRSNVSLLEPYQKCGLKRKSEEVDSNGSVQIIE
EHPPLMLQNRTVVGAAATTTTVTTKSSSSSGEGDYQLVQHEILCSMTNSYEVLEFLGRGTFGQVAKCWKR
STKEIVAIKILKNHPSYARQGQIEVSILSRLSSENADEYNFVRSYECFQHKNHTCLVFEMLEQNLYDFLK
QNKFSPLPLKYIRPILQQVATALMKLKSLGLIHADLKPENIMLVDPVRQPYRVKVIDFGSASHVSKAVCS
TYLQSRYYRAPEIILGLPFCEAIDMWSLGCVIAELFLGWPLYPGASEYDQIRYISQTQGLPAEYLLSAGT
KTTRFFNRDPNLGYPLWRLKTPEEHELETGIKSKEARKYIFNCLDDMAQVNMSTDLEGTDMLAEKADRRE
YIDLLKKMLTIDADKRITPLKTLNHQFVTMTHLLDFPHSNHVKSCFQNMEICKRRVHMYDTVSQIKSPFT
THVAPNTSTNLTMSFSNQLNTVHNQASVLASSSTAAAATLSLANSDVSLLNYQSALYPSSAAPVPGVAQQ
GVSLQPGTTQICTQTDPFQQTFIVCPPAFQTGLQATTKHSGFPVRMDNAVPIVPQAPAAQPLQIQSGVLT
QGSCTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVAL
HNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYSTIMQQPSLLTNHVTLATAQPLNVGVAHVVRQQQSSS
LPSKKNKQSAPVSSKSSLDVLPSQVYSLVGSSPLRTTSSYNSLVPVQDQHQPIIIPDTPSPPVSVITIRS
DTDEEEDNKYKPSSSGLKPRSNVISYVTVNDSPDSDSSLSSPYSTDTLSALRGNSGSVLEGPGRVVADGT
GTRTIIVPPLKTQLGDCTVATQASGLLSNKTKPVASVSGQSSGCCITPTGYRAQRGGTSAAQPLNLSQNQ
QSSAAPTSQERSSNPAPRRQQAFVAPLSQAPYTFQHGSPLHSTGHPHLAPAPAHLPSQAHLYTYAAPTSA
AALGSTSSIAHLFSPQGSSRHAAAYTTHPSTLVHQVPVSVGPSLLTSASVAPAQYQHQFATQSYIGSSRG
STIYTGYPLSPTKISQYSYL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198268
ORF Size 3630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198268.1, NM_198268.2, NP_938009
RefSeq Size 8155
RefSeq ORF 3633
Locus ID 204851
Cytogenetics 1p13.2
Protein Families Protein Kinase, Transcription Factors, Druggable Genome
MW 130.8 kDa
Gene Summary The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)