WNT2B (NM_004185) Human Tagged ORF Clone

CAT#: RC216086

Reviews ()
Write a review

WNT2B (Myc-DDK-tagged)-Human wingless-type MMTV integration site family, member 2B (WNT2B), transcript variant WNT-2B1


Product Datasheet for 'RC216086'


  "NM_004185" in other vectors (6)

Need a mutant or fragment? Switch to a different vector? Get a free quote.

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name WNT2B (NM_004185) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol WNT2B
Synonyms WNT13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC216086 representing NM_004185
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGATGGCCTTGGAGTGGTAGCCATAAGCATTTTTGGAATTCAACTAAAAACTGAAGGATCCTTGA
GGACGGCAGTACCTGGCATACCTACACAGTCAGCGTTCAACAAGTGTTTGCAAAGGTACATTGGGGCACT
GGGGGCACGAGTGATCTGTGACAATATCCCTGGTTTGGTGAGCCGGCAGCGGCAGCTGTGCCAGCGTTAC
CCAGACATCATGCGTTCAGTGGGCGAGGGTGCCCGAGAATGGATCCGAGAGTGTCAGCACCAATTCCGCC
ACCACCGCTGGAACTGTACCACCCTGGACCGGGACCACACCGTCTTTGGCCGTGTCATGCTCAGAAGTAG
CCGAGAGGCAGCTTTTGTATATGCCATCTCATCAGCAGGGGTAGTCCACGCTATTACTCGCGCCTGTAGC
CAGGGTGAACTGAGTGTGTGCAGCTGTGACCCCTACACCCGTGGCCGACACCATGACCAGCGTGGGGACT
TTGACTGGGGTGGCTGCAGTGACAACATCCACTACGGTGTCCGTTTTGCCAAGGCCTTCGTGGATGCCAA
GGAGAAGAGGCTTAAGGATGCCCGGGCCCTCATGAACTTACATAATAACCGCTGTGGTCGCACGGCTGTG
CGGCGGTTTCTGAAGCTGGAGTGTAAGTGCCATGGCGTGAGTGGTTCCTGTACTCTGCGCACCTGCTGGC
GTGCACTCTCAGATTTCCGCCGCACAGGTGATTACCTGCGGCGACGCTATGATGGGGCTGTGCAGGTGAT
GGCCACCCAAGATGGTGCCAACTTCACCGCAGCCCGCCAAGGCTATCGCCGTGCCACCCGGACTGATCTT
GTCTACTTTGACAACTCTCCAGATTACTGTGTCTTGGACAAGGCTGCAGGTTCCCTAGGCACTGCAGGCC
GTGTCTGCAGCAAGACATCAAAAGGAACAGACGGTTGTGAAATCATGTGCTGTGGCCGAGGGTACGACAC
AACTCGAGTCACCCGTGTTACCCAGTGTGAGTGCAAATTCCACTGGTGCTGTGCTGTACGGTGCAAGGAA
TGCAGAAATACTGTGGACGTCCATACTTGCAAAGCCCCCAAGAAGGCAGAGTGGCTGGACCAGACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216086 representing NM_004185
Red=Cloning site Green=Tags(s)

MLDGLGVVAISIFGIQLKTEGSLRTAVPGIPTQSAFNKCLQRYIGALGARVICDNIPGLVSRQRQLCQRY
PDIMRSVGEGAREWIRECQHQFRHHRWNCTTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACS
QGELSVCSCDPYTRGRHHDQRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAV
RRFLKLECKCHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDL
VYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWCCAVRCKE
CRNTVDVHTCKAPKKAEWLDQT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_004185
ORF Size 1116 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_004185.1, NM_004185.2, NM_004185.3, NM_004185.4, NP_004176.2
RefSeq Size 2014 bp
RefSeq ORF 1119 bp
Locus ID 7482
Cytogenetics 1p13.2
Protein Families Secreted Protein
Protein Pathways Basal cell carcinoma, Hedgehog signaling pathway, Melanogenesis, Pathways in cancer, Wnt signaling pathway
MW 41.6 kDa
Gene Summary This gene encodes a member of the wingless-type MMTV integration site (WNT) family of highly conserved, secreted signaling factors. WNT family members function in a variety of developmental processes including regulation of cell growth and differentiation and are characterized by a WNT-core domain. This gene may play a role in human development as well as carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Other Versions

Other products for "WNT2B"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


WNT2B Rabbit Polyclonal (Internal) Antibody
    • 50 ug

USD 425.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools