Meprin beta (MEP1B) (NM_005925) Human Tagged ORF Clone

CAT#: RC216063

Reviews ()
Write a review

MEP1B (Myc-DDK-tagged)-Human meprin A, beta (MEP1B)



  "NM_005925" in other vectors (5)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MEP1B
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC216063 representing NM_005925
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTATGGAATCTGTCTTGGTTTCTGTTCTTGGATGCTCTTCTCGTGATTTCTGGCTTGGCAACTC
CAGAAAACTTTGATGTAGATGGCGGAATGGACCAGGACATATTTGATATCAATGAAGGTTTGGGACTGGA
TCTTTTTGAGGGTGACATCAGACTTGATAGGGCACAAATTAGAAATTCCATCATTGGAGAAAAGTATAGA
TGGCCTCATACCATTCCATATGTTCTAGAAGATAGCTTGGAAATGAATGCTAAGGGAGTTATCCTCAATG
CATTTGAACGTTATCGCCTTAAAACATGTATTGACTTTAAGCCTTGGGCTGGAGAAACAAACTATATATC
AGTGTTCAAGGGCAGTGGCTGCTGGTCTTCAGTAGGAAATAGGCGGGTTGGGAAGCAAGAACTTTCCATC
GGGGCAAACTGTGACCGAATAGCAACAGTTCAACACGAGTTCCTCCACGCTCTGGGATTCTGGCATGAGC
AGTCGCGTTCTGACCGGGATGACTATGTCAGGATAATGTGGGACAGAATTCTGTCAGGCAGAGAGCACAA
TTTTAACACCTATAGTGACGATATATCAGATTCCCTGAATGTTCCCTATGATTACACTTCAGTAATGCAC
TACAGTAAAACTGCATTCCAAAATGGAACAGAGCCGACAATTGTCACAAGAATCTCAGACTTTGAGGATG
TGATCGGCCAACGAATGGATTTCAGTGACTCTGATCTCCTAAAGTTGAATCAACTGTATAACTGCTCCTC
TTCCTTGAGTTTTATGGACTCGTGCAGTTTTGAACTGGAAAATGTGTGTGGCATGATCCAAAGTTCAGGA
GATAATGCTGACTGGCAACGGGTTTCACAGGTTCCCAGGGGGCCAGAGAGTGATCACTCCAACATGGGCC
AGTGCCAAGGTTCTGGTTTCTTCATGCATTTCGATAGCAGCTCTGTAAATGTGGGGGCCACAGCAGTGCT
GGAAAGTAGAACGCTGTACCCTAAAAGAGGATTTCAGTGCCTGCAATTTTACTTATATAACAGTGGCAGT
GAAAGTGATCAACTGAACATCTATATCAGGGAGTATTCTGCAGACAATGTGGATGGCAATTTAACCCTTG
TGGAAGAAATAAAAGAAATACCCACTGGGAGCTGGCAACTTTATCATGTAACATTGAAAGTGACCAAGAA
GTTTAGAGTGGTGTTTGAAGGACGCAAAGGCTCTGGTGCATCACTGGGTGGTCTGTCTATTGATGACATC
AATCTTTCGGAAACACGGTGCCCTCATCATATCTGGCATATAAGGAATTTCACACAGTTCATTGGCAGCC
CAAATGGAACTCTGTATAGCCCTCCATTTTACTCTTCTAAAGGTTATGCCTTTCAGATTTACTTAAATCT
AGCCCATGTGACTAATGCAGGGATATATTTCCACTTGATCTCTGGAGCCAATGATGATCAATTACAGTGG
CCATGTCCTTGGCAACAAGCCACAATGACACTTTTGGATCAAAATCCTGACATTCGACAGCGTATGTCCA
ATCAGCGGAGTATAACTACAGACCCATTTATGACCACCGATAATGGAAACTATTTCTGGGACAGGCCTTC
TAAAGTGGGAACAGTGGCTTTGTTCTCTAATGGAACTCAGTTTAGAAGAGGTGGGGGCTATGGAACCAGT
GCCTTTATAACCCACGAAAGGCTGAAAAGCAGAGATTTTATAAAAGGAGATGATGTTTATATCCTACTGA
CAGTGGAAGACATATCTCACCTCAACTCTACACAAATCCAGCTAACACCAGCCCCTAGTGTTCAAGACCT
CTGCTCAAAAACCACCTGTAAAAATGACGGTGTCTGCACTGTTCGAGATGGCAAAGCTGAGTGCAGGTGC
CAGTCAGGGGAAGACTGGTGGTACATGGGAGAAAGGTGTGAAAAGAGAGGCTCCACCCGAGACACCATAG
TCATTGCTGTTTCATCTACTGTTGCTGTGTTTGCCTTGATGCTGATCATCACCCTTGTCAGTGTCTATTG
CACCAGGAAGAAATATCGTGAAAGGATGAGCTCAAATCGACCAAATTTGACTCCGCAAAATCAGCATGCT
TTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC216063 representing NM_005925
Red=Cloning site Green=Tags(s)

MDLWNLSWFLFLDALLVISGLATPENFDVDGGMDQDIFDINEGLGLDLFEGDIRLDRAQIRNSIIGEKYR
WPHTIPYVLEDSLEMNAKGVILNAFERYRLKTCIDFKPWAGETNYISVFKGSGCWSSVGNRRVGKQELSI
GANCDRIATVQHEFLHALGFWHEQSRSDRDDYVRIMWDRILSGREHNFNTYSDDISDSLNVPYDYTSVMH
YSKTAFQNGTEPTIVTRISDFEDVIGQRMDFSDSDLLKLNQLYNCSSSLSFMDSCSFELENVCGMIQSSG
DNADWQRVSQVPRGPESDHSNMGQCQGSGFFMHFDSSSVNVGATAVLESRTLYPKRGFQCLQFYLYNSGS
ESDQLNIYIREYSADNVDGNLTLVEEIKEIPTGSWQLYHVTLKVTKKFRVVFEGRKGSGASLGGLSIDDI
NLSETRCPHHIWHIRNFTQFIGSPNGTLYSPPFYSSKGYAFQIYLNLAHVTNAGIYFHLISGANDDQLQW
PCPWQQATMTLLDQNPDIRQRMSNQRSITTDPFMTTDNGNYFWDRPSKVGTVALFSNGTQFRRGGGYGTS
AFITHERLKSRDFIKGDDVYILLTVEDISHLNSTQIQLTPAPSVQDLCSKTTCKNDGVCTVRDGKAECRC
QSGEDWWYMGERCEKRGSTRDTIVIAVSSTVAVFALMLIITLVSVYCTRKKYRERMSSNRPNLTPQNQHA
F

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005925
ORF Size 2103 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005925.3
RefSeq Size 2327 bp
RefSeq ORF 2106 bp
Locus ID 4225
UniProt ID Q16820
Cytogenetics 18q12.1
Protein Families Druggable Genome, Transmembrane
MW 79.4 kDa
Gene Summary Meprins are multidomain zinc metalloproteases that are highly expressed in mammalian kidney and intestinal brush border membranes, and in leukocytes and certain cancer cells. They are involved in the hydrolysis of a variety of peptide and protein substrates, and have been implicated in cancer and intestinal inflammation. Mature meprins are oligomers of evolutionarily related, but separately encoded alpha and/or beta subunits. Homooligomers of alpha subunit are secreted, whereas, oligomers containing the beta subunit are plasma membrane-bound. This gene encodes the beta subunit. Targeted disruption of this gene in mice affects embryonic viability, renal gene expression profiles, and distribution of the membrane-associated alpha subunit in kidney and intestine. [provided by RefSeq, Oct 2011]

Other Versions

Other products for "MEP1B"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


MEP1B Rabbit polyclonal Antibody
    • 100 ul

USD 275.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.