CARD9 (NM_052813) Human Tagged ORF Clone

CAT#: RC215899

Reviews ()
Write a review

CARD9 (Myc-DDK-tagged)-Human caspase recruitment domain family, member 9 (CARD9), transcript variant 1



  "NM_052813" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 567.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CARD9
Synonyms CANDF2; hCARD9
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215899 representing NM_052813
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGACTACGAGAACGATGACGAGTGCTGGAACGTCCTGGAGGGCTTCCGGGTGACGCTCACCTCGG
TCATCGACCCCTCACGCATCACACCTTACCTGCGGCAGTGCAAGGTCCTGAACCCTGATGATGAGGAGCA
GGTGCTCAGCGACCCCAACCTGGTCATCCGCAAACGGAAAGTGGGTGTGCTCCTGGACATCCTGCAGCGG
ACCGGCCACAAGGGCTACGTGGCCTTCCTCGAGAGCCTGGAGCTCTACTACCCGCAGCTGTACAAGAAGG
TCACAGGCAAGGAGCCGGCCCGCGTCTTCTCCATGATCATCGACGCGTCCGGGGAGTCAGGCCTGACTCA
GCTGCTGATGACTGAGGTCATGAAGCTGCAGAAGAAGGTGCAGGACCTGACCGCGCTGCTGAGCTCCAAA
GATGACTTCATCAAGGAGCTGCGGGTGAAGGACAGCCTGCTGCGCAAGCACCAGGAGCGTGTGCAGAGGC
TCAAGGAGGAGTGCGAGGCCGGCAGCCGCGAGCTCAAGCGCTGCAAGGAGGAGAACTACGACCTGGCCAT
GCGCCTGGCGCACCAGAGTGAGGAGAAGGGCGCCGCGCTCATGCGGAACCGTGACCTGCAGCTGGAGATT
GACCAGCTCAAGCACAGCCTCATGAAGGCCGAGGACGACTGCAAGGTGGAGCGCAAGCACACGCTGAAGC
TCAGGCACGCCATGGAGCAGCGGCCCAGCCAGGAGCTGCTGTGGGAGCTGCAGCAGGAGAAGGCCCTGCT
CCAGGCCCGGGTGCAGGAGCTGGAGGCCTCCGTCCAGGAGGGGAAGCTGGACAGGAGCAGCCCCTACATC
CAGGTACTGGAGGAGGACTGGCGGCAGGCGCTGCGGGACCACCAGGAGCAGGCCAACACCATCTTCTCCC
TGCGCAAGGACCTCCGCCAGGGCGAGGCCCGACGCCTCCGGTGCATGGAGGAGAAGGAGATGTTCGAGCT
GCAGTGCCTGGCACTACGTAAGGACTCCAAGATGTACAAGGACCGCATCGAGGCCATCCTGCTGCAGATG
GAGGAGGTCGCCATTGAGCGGGACCAGGCCATAGCCACGCGGGAGGAGCTGCACGCACAGCACGCCCGGG
GCCTGCAGGAGAAGGACGCGCTGCGCAAGCAGGTGCGGGAGCTGGGCGAGAAGGCGGATGAGCTGCAGCT
GCAGGTGTTCCAGTGTGAGGCGCAGCTACTGGCCGTGGAGGGCAGGCTCAGGCGGCAGCAGCTGGAGACG
CTCGTCCTGAGCTCCGACCTGGAAGATGGCTCACCCAGGAGGTCCCAGGAGCTCTCACTCCCCCAGGACC
TGGAGGACACCCAGCTCTCAGACAAAGGCTGCCTTGCCGGCGGGGGGAGCCCGAAACAGCCCTTTGCAGC
TCTGCACCAGGAGCAGGTTTTGCGGAACCCCCATGACGCAGGCCTGAGCAGCGGGGAGCCGCCCGAGAAG
GAGCGGCGGCGCCTCAAAGAGAGTTTTGAGAACTACCGCAGGAAGCGCGCCCTCAGGAAGATGCAGAAAG
GATGGCGGCAGGGGGAGGAGGACCGGGAGAACACCACGGGCAGCGACAACACCGACACTGAGGGCTCC


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>RC215899 representing NM_052813
Red=Cloning site Green=Tags(s)

MSDYENDDECWNVLEGFRVTLTSVIDPSRITPYLRQCKVLNPDDEEQVLSDPNLVIRKRKVGVLLDILQR
TGHKGYVAFLESLELYYPQLYKKVTGKEPARVFSMIIDASGESGLTQLLMTEVMKLQKKVQDLTALLSSK
DDFIKELRVKDSLLRKHQERVQRLKEECEAGSRELKRCKEENYDLAMRLAHQSEEKGAALMRNRDLQLEI
DQLKHSLMKAEDDCKVERKHTLKLRHAMEQRPSQELLWELQQEKALLQARVQELEASVQEGKLDRSSPYI
QVLEEDWRQALRDHQEQANTIFSLRKDLRQGEARRLRCMEEKEMFELQCLALRKDSKMYKDRIEAILLQM
EEVAIERDQAIATREELHAQHARGLQEKDALRKQVRELGEKADELQLQVFQCEAQLLAVEGRLRRQQLET
LVLSSDLEDGSPRRSQELSLPQDLEDTQLSDKGCLAGGGSPKQPFAALHQEQVLRNPHDAGLSSGEPPEK
ERRRLKESFENYRRKRALRKMQKGWRQGEEDRENTTGSDNTDTEGS

TRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_052813
ORF Size 1608 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_052813.5
RefSeq Size 2136 bp
RefSeq ORF 1611 bp
Locus ID 64170
UniProt ID Q9H257
Cytogenetics 9q34.3
Protein Families Druggable Genome
Protein Pathways NOD-like receptor signaling pathway
MW 62.1 kDa
Gene Summary The protein encoded by this gene is a member of the CARD protein family, which is defined by the presence of a characteristic caspase-associated recruitment domain (CARD). CARD is a protein interaction domain known to participate in activation or suppression of CARD containing members of the caspase family, and thus plays an important regulatory role in cell apoptosis. This protein was identified by its selective association with the CARD domain of BCL10, a postive regulator of apoptosis and NF-kappaB activation, and is thought to function as a molecular scaffold for the assembly of a BCL10 signaling complex that activates NF-kappaB. Several alternatively spliced transcript variants have been observed, but their full-length nature is not clearly defined. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CARD9"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.