SMC1 (SMC1A) (NM_006306) Human Tagged ORF Clone

CAT#: RC215888

Reviews ()
Write a review

SMC1A (Myc-DDK-tagged)-Human structural maintenance of chromosomes 1A (SMC1A)



Reconstitution Protocol

USD 1,073.00

In Stock*

Size
    • 10 ug

Product images

Other products for "SMC1A"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SMC1A
Synonyms CDLS2; DEE85; DXS423E; EIEE85; SB1.8; SMC1; SMC1alpha; SMC1L1; SMCB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215888 representing NM_006306
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGTTCCTGAAACTGATTGAGATTGAGAACTTTAAGTCGTACAAGGGTCGACAGATTATCGGACCAT
TTCAGAGGTTCACCGCCATCATTGGACCCAATGGCTCTGGTAAGTCAAATCTCATGGATGCCATCAGCTT
TGTGCTAGGTGAAAAAACCAGCAACCTGCGGGTAAAGACCCTGCGGGACCTGATCCATGGAGCTCCTGTG
GGCAAGCCAGCTGCCAACCGGGCCTTTGTCAGCATGGTCTACTCTGAGGAGGGTGCTGAGGACCGTACCT
TTGCCCGTGTCATTGTAGGAGGTTCTTCTGAGTACAAGATCAACAACAAAGTGGTCCAACTACATGAGTA
CAGTGAGGAATTAGAGAAGTTGGGCATTCTCATCAAAGCTCGTAACTTCCTCGTTTTCCAGGGTGCTGTG
GAATCTATTGCCATGAAGAACCCCAAAGAGAGGACAGCTCTATTTGAAGAGATTAGTCGTTCTGGGGAGC
TGGCGCAGGAGTATGACAAGCGAAAGAAGGAAATGGTGAAGGCTGAAGAGGACACACAGTTTAATTACCA
TCGCAAGAAAAATATTGCGGCTGAACGCAAGGAAGCAAAGCAGGAGAAAGAAGAGGCTGACCGGTACCAG
CGCCTGAAGGATGAGGTAGTACGGGCTCAGGTACAGCTGCAGCTCTTTAAGCTTTACCATAATGAAGTGG
AAATTGAGAAGCTCAACAAGGAACTGGCCTCAAAGAACAAGGAGATCGAGAAGGACAAGAAGCGTATGGA
CAAGGTGGAGGATGAACTGAAGGAGAAGAAGAAGGAGCTGGGCAAAATGATGCGGGAGCAGCAGCAGATT
GAGAAGGAGATCAAGGAGAAGGACTCAGAATTGAACCAGAAGCGGCCTCAGTACATCAAAGCCAAGGAGA
ACACCTCCCACAAAATCAAGAAGCTGGAAGCAGCCAAGAAGTCTCTGCAGAATGCTCAGAAGCACTACAA
GAAGCGTAAAGGTGACATGGATGAGCTGGAGAAGGAGATGCTGTCAGTGGAGAAGGCTCGGCAGGAGTTT
GAAGAACGGATGGAAGAAGAGAGTCAGAGTCAGGGCAGAGATTTGACGTTGGAGGAGAATCAGGTGAAGA
AATACCACCGGTTGAAAGAAGAAGCCAGCAAGAGAGCAGCTACCCTGGCCCAGGAGCTGGAGAAATTCAA
TCGAGACCAGAAAGCTGACCAGGACCGTCTGGATCTGGAAGAACGGAAGAAAGTAGAGACAGAGGCCAAG
ATCAAGCAAAAGCTGCGGGAAATTGAAGAGAATCAGAAGCGGATTGAGAAACTGGAGGAATACATCACCA
CTAGCAAGCAGTCCCTAGAAGAGCAGAAGAAGCTAGAGGGGGAGCTGACAGAGGAGGTGGAGATGGCCAA
GCGGCGTATTGATGAAATCAATAAGGAGCTGAACCAGGTGATGGAGCAGCTAGGGGATGCCCGCATCGAC
CGCCAGGAGAGCAGCCGCCAGCAGCGAAAGGCAGAGATAATGGAAAGCATCAAGCGCCTTTACCCTGGCT
CTGTGTACGGCCGCCTCATTGACCTATGCCAGCCCACACAAAAGAAGTATCAGATTGCTGTAACCAAGGT
TTTGGGCAAGAACATGGATGCCATTATTGTGGACTCGGAGAAGACAGGCCGGGACTGTATTCAGTATATC
AAGGAGCAGCGTGGGGAGCCTGAGACCTTCTTGCCTCTTGACTACCTGGAGGTGAAGCCTACAGATGAGA
AACTCCGGGAGCTGAAGGGGGCCAAGCTAGTGATTGATGTGATTCGCTATGAGCCACCTCATATCAAAAA
GGCCCTGCAGTATGCTTGTGGCAATGCCCTTGTCTGTGACAACGTGGAAGATGCCCGCCGCATTGCCTTT
GGAGGCCACCAGCGCCACAAGACAGTGGCACTGGATGGAACCCTATTCCAGAAGTCAGGAGTGATCTCTG
GTGGGGCCAGTGACCTGAAGGCCAAGGCACGGCGCTGGGATGAGAAAGCAGTAGACAAGTTGAAAGAGAA
GAAGGAGCGCTTGACAGAGGAGCTGAAAGAGCAGATGAAGGCAAAACGGAAAGAGGCAGAGCTGCGTCAG
GTGCAGTCTCAGGCCCATGGACTGCAGATGCGGCTCAAGTACTCCCAGAGTGACCTAGAACAGACCAAGA
CACGACATCTAGCCCTGAATCTGCAGGAAAAATCCAAGCTGGAGAGTGAGCTAGCCAACTTTGGGCCTCG
CATTAATGATATCAAGAGGATCATTCAGAGCCGAGAGAGGGAAATGAAAGACTTGAAGGAGAAGATGAAC
CAGGTAGAGGATGAGGTGTTTGAAGAGTTTTGTCGGGAGATTGGTGTGCGCAACATCCGGGAGTTTGAGG
AAGAAAAGGTGAAACGGCAGAATGAAATCGCCAAGAAGCGTTTGGAGTTTGAGAATCAGAAGACTCGCTT
GGGCATTCAGTTGGATTTTGAAAAGAACCAACTGAAGGAGGACCAAGATAAAGTACACATGTGGGAGCAG
ACAGTGAAAAAAGATGAAAATGAGATAGAAAAGCTCAAAAAGGAGGAACAAAGACACATGAAGATCATAG
ATGAGACCATGGCTCAGCTACAAGACCTGAAGAATCAGCATCTGGCCAAGAAGTCGGAAGTGAATGACAA
GAATCATGAGATGGAGGAGATTCGTAAGAAACTCGGGGGCGCCAACAAGGAAATGACCCATTTACAGAAG
GAGGTGACAGCCATTGAGACCAAGCTTGAACAGAAGCGCAGTGACCGTCACAACTTGCTACAGGCCTGTA
AGATGCAGGACATTAAGTTGCCACTGTCAAAAGGCACCATGGATGATATTAGTCAGGAAGAGGGTAGCTC
CCAGGGGGAGGACTCAGTGAGTGGTTCACAGAGAATTTCCAGTATCTATGCACGAGAGGCCCTCATTGAG
ATTGACTACGGTGATCTGTGTGAGGATCTGAAGGATGCCCAGGCTGAGGAAGAGATCAAGCAAGAGATGA
ACACACTGCAGCAGAAGCTGAATGAGCAGCAGAGTGTGCTTCAGCGTATTGCCGCCCCCAACATGAAGGC
CATGGAAAAGCTGGAAAGTGTCCGAGACAAGTTCCAGGAGACCTCAGATGAGTTTGAAGCAGCCCGAAAG
CGAGCAAAGAAGGCCAAGCAGGCATTCGAACAGATCAAGAAGGAGCGCTTTGACCGCTTCAATGCTTGTT
TTGAATCTGTGGCTACCAACATTGATGAGATCTATAAGGCCCTGTCCCGCAATAGCAGTGCCCAGGCATT
CCTGGGCCCTGAGAACCCTGAAGAGCCCTACTTGGATGGCATCAACTACAACTGTGTGGCTCCTGGGAAA
CGCTTCCGGCCTATGGACAACTTGTCAGGCGGGGAGAAGACAGTGGCAGCTCTGGCCCTGCTCTTTGCCA
TCCACAGCTACAAGCCAGCCCCCTTCTTCGTCCTGGATGAGATTGATGCTGCCTTGGATAACACCAACAT
TGGCAAGGTGGCAAATTACATCAAGGAGCAGTCGACTTGCAACTTCCAGGCCATCGTCATCTCTCTCAAG
GAGGAGTTCTACACCAAGGCCGAGAGCCTCATTGGAGTCTATCCTGAGCAAGGGGACTGTGTGATCAGCA
AAGTCCTGACCTTCGACCTCACCAAGTACCCAGATGCCAACCCCAACCCCAATGAGCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215888 representing NM_006306
Red=Cloning site Green=Tags(s)

MGFLKLIEIENFKSYKGRQIIGPFQRFTAIIGPNGSGKSNLMDAISFVLGEKTSNLRVKTLRDLIHGAPV
GKPAANRAFVSMVYSEEGAEDRTFARVIVGGSSEYKINNKVVQLHEYSEELEKLGILIKARNFLVFQGAV
ESIAMKNPKERTALFEEISRSGELAQEYDKRKKEMVKAEEDTQFNYHRKKNIAAERKEAKQEKEEADRYQ
RLKDEVVRAQVQLQLFKLYHNEVEIEKLNKELASKNKEIEKDKKRMDKVEDELKEKKKELGKMMREQQQI
EKEIKEKDSELNQKRPQYIKAKENTSHKIKKLEAAKKSLQNAQKHYKKRKGDMDELEKEMLSVEKARQEF
EERMEEESQSQGRDLTLEENQVKKYHRLKEEASKRAATLAQELEKFNRDQKADQDRLDLEERKKVETEAK
IKQKLREIEENQKRIEKLEEYITTSKQSLEEQKKLEGELTEEVEMAKRRIDEINKELNQVMEQLGDARID
RQESSRQQRKAEIMESIKRLYPGSVYGRLIDLCQPTQKKYQIAVTKVLGKNMDAIIVDSEKTGRDCIQYI
KEQRGEPETFLPLDYLEVKPTDEKLRELKGAKLVIDVIRYEPPHIKKALQYACGNALVCDNVEDARRIAF
GGHQRHKTVALDGTLFQKSGVISGGASDLKAKARRWDEKAVDKLKEKKERLTEELKEQMKAKRKEAELRQ
VQSQAHGLQMRLKYSQSDLEQTKTRHLALNLQEKSKLESELANFGPRINDIKRIIQSREREMKDLKEKMN
QVEDEVFEEFCREIGVRNIREFEEEKVKRQNEIAKKRLEFENQKTRLGIQLDFEKNQLKEDQDKVHMWEQ
TVKKDENEIEKLKKEEQRHMKIIDETMAQLQDLKNQHLAKKSEVNDKNHEMEEIRKKLGGANKEMTHLQK
EVTAIETKLEQKRSDRHNLLQACKMQDIKLPLSKGTMDDISQEEGSSQGEDSVSGSQRISSIYAREALIE
IDYGDLCEDLKDAQAEEEIKQEMNTLQQKLNEQQSVLQRIAAPNMKAMEKLESVRDKFQETSDEFEAARK
RAKKAKQAFEQIKKERFDRFNACFESVATNIDEIYKALSRNSSAQAFLGPENPEEPYLDGINYNCVAPGK
RFRPMDNLSGGEKTVAALALLFAIHSYKPAPFFVLDEIDAALDNTNIGKVANYIKEQSTCNFQAIVISLK
EEFYTKAESLIGVYPEQGDCVISKVLTFDLTKYPDANPNPNEQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006306
ORF Size 3699 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006306.4
RefSeq Size 9725 bp
RefSeq ORF 3702 bp
Locus ID 8243
UniProt ID Q14683
Cytogenetics Xp11.22
Domains SMC_N, SMC_C, KID
Protein Families Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis
MW 143.1 kDa
Gene Summary Proper cohesion of sister chromatids is a prerequisite for the correct segregation of chromosomes during cell division. The cohesin multiprotein complex is required for sister chromatid cohesion. This complex is composed partly of two structural maintenance of chromosomes (SMC) proteins, SMC3 and either SMC1B or the protein encoded by this gene. Most of the cohesin complexes dissociate from the chromosomes before mitosis, although those complexes at the kinetochore remain. Therefore, the encoded protein is thought to be an important part of functional kinetochores. In addition, this protein interacts with BRCA1 and is phosphorylated by ATM, indicating a potential role for this protein in DNA repair. This gene, which belongs to the SMC gene family, is located in an area of the X-chromosome that escapes X inactivation. Mutations in this gene result in Cornelia de Lange syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.