FA20A(FAM20A) (NM_017565) Human Tagged ORF Clone

CAT#: RC215864

FAM20A (Myc-DDK-tagged)-Human family with sequence similarity 20, member A (FAM20A), transcript variant 1

Need custom modification / cloning service?
Get a free quote

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name FA20A(FAM20A) (NM_017565) Human Tagged ORF Clone
Symbol FAM20A
Synonyms AI1G; AIGFS; FP2747
Vector pCMV6-Entry
Sequence Data
>RC215864 representing NM_017565
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGGGGCTGCGCCGGGACCGCCTACTGACTCTGCTGCTGCTGGGCGCGCTGCTCTCCGCCGACCTCT
ACTTCCACCTCTGGCCCCAAGTACAGCGCCAGCTGCGGCCTCGGGAGCGCCCGCGGGGGTGCCCGTGCAC
CGGCCGCGCCTCCTCCCTGGCGCGGGACTCGGCCGCAGCTGCCTCGGACCCCGGCACGATCGTGCACAAC
TTTTCCCGAACCGAGCCCCGGACTGAACCGGCTGGCGGCAGCCACAGCGGGTCGAGCTCCAAGTTGCAGG
CCCTCTTCGCCCACCCGCTGTACAACGTCCCGGAGGAGCCGCCTCTCCTGGGAGCCGAGGACTCACTCCT
GGCCAGCCAGGAGGCGCTGCGGTATTACCGGAGGAAGGTGGCCCGCTGGAACAGGCGACACAAGATGTAC
AGAGAGCAGATGAACCTTACCTCCCTGGACCCCCCACTGCAGCTCCGACTCGAGGCCAGCTGGGTCCAGT
TCCACCTGGGTATTAACCGCCATGGGCTCTACTCCCGGTCCAGCCCTGTTGTCAGCAAACTTCTGCAAGA
CATGAGGCACTTTCCCACCATCAGTGCTGATTACAGTCAAGATGAGAAAGCCTTGCTGGGGGCATGTGAC
TGCACCCAGATTGTGAAACCCAGTGGGGTCCACCTCAAGCTGGTGCTGAGGTTCTCGGATTTCGGGAAGG
CCATGTTCAAACCCATGAGACAGCAGCGAGATGAAGAGACACCAGTGGACTTCTTCTACTTCATTGACTT
TCAGAGACACAATGCTGAGATCGCAGCTTTCCATCTGGACAGGATTCTGGACTTCCGACGGGTGCCGCCA
ACAGTGGGGAGGATAGTAAATGTCACCAAGGAAATCCTAGAGGTCACCAAGAATGAAATCCTGCAGAGTG
TTTTCTTTGTCTCTCCAGCGAGCAACGTGTGCTTCTTCGCCAAGTGTCCATACATGTGCAAGACGGAGTA
TGCTGTCTGTGGCAAACCACACCTGCTGGAGGGTTCCCTCTCTGCCTTCCTGCCGTCCCTCAACCTGGCC
CCCAGGCTGTCTGTGCCCAACCCCTGGATCCGCTCCTACACACTGGCAGGAAAAGAGGAGTGGGAGGTCA
ATCCCCTTTACTGTGACACAGTGAAACAGATCTACCCGTACAACAACAGCCAGCGGCTCCTCAATGTCAT
CGACATGGCCATCTTCGACTTCTTGATAGGGAATATGGACCGGCACCATTATGAGATGTTCACCAAGTTC
GGGGATGATGGGTTCCTTATTCACCTTGACAACGCCAGAGGGTTCGGACGACACTCCCATGATGAAATCT
CCATCCTCTCGCCTCTCTCCCAGTGCTGCATGATAAAAAAGAAAACACTTTTGCACCTGCAGCTGCTGGC
CCAAGCTGACTACAGACTCAGCGATGTGATGCGAGAATCACTGCTGGAAGACCAGCTCAGCCCTGTCCTC
ACTGAACCCCACCTCCTTGCCCTGGATCGAAGGCTCCAAACCATCCTAAGGACAGTGGAGGGGTGCATAG
TGGCCCATGGACAGCAGAGTGTCATAGTCGACGGCCCAGTGGAACAGTCGGCCCCAGACTCTGGCCAGGC
TAACTTGACAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215864 representing NM_017565
Red=Cloning site Green=Tags(s)

MPGLRRDRLLTLLLLGALLSADLYFHLWPQVQRQLRPRERPRGCPCTGRASSLARDSAAAASDPGTIVHN
FSRTEPRTEPAGGSHSGSSSKLQALFAHPLYNVPEEPPLLGAEDSLLASQEALRYYRRKVARWNRRHKMY
REQMNLTSLDPPLQLRLEASWVQFHLGINRHGLYSRSSPVVSKLLQDMRHFPTISADYSQDEKALLGACD
CTQIVKPSGVHLKLVLRFSDFGKAMFKPMRQQRDEETPVDFFYFIDFQRHNAEIAAFHLDRILDFRRVPP
TVGRIVNVTKEILEVTKNEILQSVFFVSPASNVCFFAKCPYMCKTEYAVCGKPHLLEGSLSAFLPSLNLA
PRLSVPNPWIRSYTLAGKEEWEVNPLYCDTVKQIYPYNNSQRLLNVIDMAIFDFLIGNMDRHHYEMFTKF
GDDGFLIHLDNARGFGRHSHDEISILSPLSQCCMIKKKTLLHLQLLAQADYRLSDVMRESLLEDQLSPVL
TEPHLLALDRRLQTILRTVEGCIVAHGQQSVIVDGPVEQSAPDSGQANLTS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017565
ORF Size 1623 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017565.1, NM_017565.2, NM_017565.3, NP_060035
RefSeq Size 2267
RefSeq ORF 1626
Locus ID 54757
Cytogenetics 17q24.2
Protein Families Secreted Protein, Transmembrane
MW 61.2 kDa
Gene Summary This locus encodes a protein that is likely secreted and may function in hematopoiesis. A mutation at this locus has been associated with amelogenesis imperfecta and gingival hyperplasia syndrome. Alternatively spliced transcript variants have been identified. [provided by RefSeq, Aug 2011].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)