BMP2K (NM_198892) Human Tagged ORF Clone

CAT#: RC215795

BMP2K (Myc-DDK-tagged)-Human BMP2 inducible kinase (BMP2K), transcript variant 1

Clone Modification / Custom Cloning Service

USD 1,772.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BMP2K (NM_198892) Human Tagged ORF Clone
Symbol BMP2K
Synonyms BIKE; HRIHFB2017
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215795 representing NM_198892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAAGTTCTCTCGGATGCCCAAGTCGGAGGGCGGCAGCGGCGGCGGAGCGGCGGGTGGCGGGGCTG
GCGGGGCCGGGGCCGGGGCCGGCTGCGGCTCCGGCGGCTCGTCCGTGGGGGTCCGGGTGTTCGCGGTCGG
CCGCCACCAGGTCACCCTGGAAGAGTCGCTGGCCGAAGGTGGATTCTCCACAGTTTTCCTCGTGCGTACT
CACGGTGGAATCCGATGTGCATTGAAGCGAATGTATGTCAATAACATGCCAGACCTCAATGTTTGTAAAA
GGGAAATTACAATTATGAAAGAGCTATCTGGTCACAAAAATATTGTGGGCTATTTGGACTGTGCTGTTAA
TTCAATTAGTGATAATGTATGGGAAGTCCTTATCTTAATGGAATATTGTCGAGCTGGACAGGTAGTGAAT
CAAATGAATAAGAAGCTACAGACGGGTTTTACAGAACCAGAAGTGTTACAGATATTCTGTGATACCTGTG
AAGCTGTTGCAAGGTTGCATCAGTGTAAGACTCCAATAATTCACCGGGATCTGAAGGTAGAAAATATTTT
GTTGAATGATGGTGGGAACTATGTACTTTGTGACTTTGGCAGTGCCACTAATAAATTTCTTAATCCTCAA
AAAGATGGAGTTAATGTAGTAGAAGAAGAAATTAAAAAGTATACAACTCTGTCATACAGAGCCCCTGAAA
TGATCAACCTTTATGGAGGGAAACCCATCACCACCAAGGCTGATATCTGGGCACTGGGATGTCTACTCTA
TAAACTTTGTTTCTTCACTCTTCCTTTTGGTGAGAGTCAGGTTGCTATCTGTGATGGCAACTTCACCATC
CCAGACAATTCTCGTTACTCCCGTAACATACATTGCTTAATAAGGTTCATGCTTGAACCAGATCCGGAAC
ATAGACCTGATATATTTCAAGTGTCATATTTTGCATTTAAATTTGCCAAAAAGGATTGTCCAGTCTCCAA
CATCAATAATTCTTCTATTCCTTCAGCTCTTCCTGAACCGATGACTGCTAGTGAAGCAGCTGCTAGGAAA
AGCCAAATAAAAGCCAGAATAACAGATACCATTGGACCAACAGAAACCTCAATTGCACCAAGACAAAGAC
CAAAGGCCAACTCTGCTACTACTGCCACTCCCAGTGTGCTGACCATTCAAAGTTCAGCAACACCTGTTAA
AGTCCTTGCTCCTGGTGAATTCGGTAACCATAGACCAAAAGGGGCACTAAGACCTGGAAATGGCCCTGAA
ATTTTATTGGGTCAGGGACCTCCTCAGCAGCCGCCACAGCAGCATAGAGTACTCCAGCAACTACAGCAGG
GAGATTGGAGATTACAGCAACTCCATTTACAGCATCGTCATCCTCACCAGCAGCAGCAGCAGCAGCAGCA
GCAACAGCAACAGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCACCACCACCAC
CACCACCACCACCTACTTCAAGATGCTTATATGCAGCAGTATCAACATGCAACACAGCAGCAACAGATGC
TTCAACAACAATTTTTAATGCATTCGGTATATCAACCACAACCTTCTGCATCACAGTATCCTACAATGAT
GCCGCAGTATCAGCAGGCTTTCTTTCAACAGCAGATGCTAGCTCAACATCAGCCGTCTCAACAACAGGCA
TCACCTGAATATCTTACCTCCCCTCAAGAGTTCTCACCAGCCTTAGTTTCCTACACTTCATCACTTCCAG
CTCAGGTTGGAACCATAATGGACTCCTCCTATAGTGCCAATAGGTCAGTTGCTGATAAAGAGGCCATTGC
AAATTTCACAAATCAGAAGAACATCAGCAATCCACCTGATATGTCAGGGTGGAATCCTTTTGGAGAGGAT
AATTTCTCTAAGTTAACAGAAGAGGAACTATTGGACAGAGAATTTGACCTTCTAAGATCAAATAGGCTCG
AGGAGAGAGCATCCTCAGATAAGAATGTAGACTCACTTTCTGCTCCACATAACCATCCTCCAGAAGATCC
TTTTGGTTCTGTTCCTTTCATTTCTCATTCAGGTTCTCCTGAAAAGAAAGCTGAACATTCATCTATAAAT
CAAGAAAATGGCACTGCAAACCCTATCAAGAACGGTAAAACAAGTCCAGCATCTAAAGATCAGCGGACTG
GAAAGAAAACCTCAGTACAGGGTCAAGTGCAAAAGGGGAATGATGAATCTGAAAGTGATTTTGAATCAGA
TCCCCCTTCTCCTAAGAGCAGTGAAGAGGAAGAGCAAGATGATGAAGAAGTTCTTCAGGGGGAACAAGGA
GATTTTAATGATGATGATACTGAACCAGAAAATCTGGGTCATAGGCCTCTCCTCATGGATTCTGAAGATG
AGGAAGAAGAGGAGAAACATAGCTCTGATTCTGATTATGAGCAGGCTAAAGCAAAGTACAGTGACATGAG
CTCTGTCTACAGAGACAGATCTGGCAGTGGACCAACCCAAGATCTTAATACAATACTCCTCACCTCAGCC
CAATTATCCTCTGATGTTGCAGTGGAGACTCCCAAACAGGAGTTTGATGTATTTGGCGCTGTCCCCTTCT
TTGCAGTGCGTGCTCAACAGCCCCAGCAAGAAAAGAATGAAAAGAACCTCCCTCAACACAGGTTTCCTGC
TGCAGGACTGGAGCAGGAGGAATTTGATGTATTCACAAAGGCGCCTTTTAGCAAGAAGGTGAATGTACAA
GAATGCCATGCAGTGGGGCCTGAGGCACATACTATCCCTGGTTATCCCAAAAGTGTAGATGTATTTGGCT
CCACTCCATTTCAGCCCTTCCTCACATCAACAAGTAAAAGTGAAAGCAATGAGGACCTTTTTGGGCTTGT
GCCCTTTGATGAAATAACGGGGAGCCAGCAGCAAAAAGTCAAACAGCGCAGCTTACAGAAACTGTCCTCT
CGCCAAAGGCGCACAAAGCAGGATATGTCCAAAAGTAATGGGAAGCGGCATCATGGCACGCCAACTAGCA
CAAAGAAGACTTTGAAGCCTACCTATCGCACTCCAGAGAGGGCTCGCAGGCACAAAAAAGTGGGCCGCCG
AGACTCTCAAAGTAGCAATGAATTTTTAACCATCTCAGACTCCAAGGAGAACATTAGTGTTGCACTGACT
GATGGGAAAGATAGGGGGAATGTCTTACAACCTGAGGAGAGCCTGTTGGACCCCTTCGGTGCCAAGCCCT
TCCATTCTCCAGACCTGTCATGGCACCCTCCACATCAGGGCCTGAGCGACATCCGTGCTGATCACAATAC
TGTCCTGCCAGGGCGGCCAAGACAAAATTCACTACATGGGTCATTCCATAGTGCAGATGTATTGAAAATG
GATGATTTTGGTGCCGTGCCCTTTACAGAACTTGTGGTGCAAAGCATCACTCCACATCAGTCCCAACAGT
CCCAACCAGTCGAATTAGACCCATTTGGTGCTGCTCCATTTCCTTCTAAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215795 representing NM_198892
Red=Cloning site Green=Tags(s)

MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRT
HGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVN
QMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQ
KDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTI
PDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARK
SQIKARITDTIGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQQQQQQQHHHH
HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQA
SPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGED
NFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSIN
QENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQG
DFNDDDTEPENLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTKAPFSKKVNVQ
ECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFDEITGSQQQKVKQRSLQKLSS
RQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARRHKKVGRRDSQSSNEFLTISDSKENISVALT
DGKDRGNVLQPEESLLDPFGAKPFHSPDLSWHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKM
DDFGAVPFTELVVQSITPHQSQQSQPVELDPFGAAPFPSKQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_198892
ORF Size 3483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_198892.1, NP_942595
RefSeq Size 3859
RefSeq ORF 3486
Locus ID 55589
Cytogenetics 4q21.21
Protein Families Protein Kinase, Druggable Genome
MW 129 kDa
Gene Summary This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)