BMP2K (NM_198892) Human Tagged ORF Clone

CAT#: RC215795

Reviews ()
Write a review

BMP2K (Myc-DDK-tagged)-Human BMP2 inducible kinase (BMP2K), transcript variant 1



Reconstitution Protocol

USD 1,011.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "BMP2K"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BMP2K
Synonyms BIKE; HRIHFB2017
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215795 representing NM_198892
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGAAGTTCTCTCGGATGCCCAAGTCGGAGGGCGGCAGCGGCGGCGGAGCGGCGGGTGGCGGGGCTG
GCGGGGCCGGGGCCGGGGCCGGCTGCGGCTCCGGCGGCTCGTCCGTGGGGGTCCGGGTGTTCGCGGTCGG
CCGCCACCAGGTCACCCTGGAAGAGTCGCTGGCCGAAGGTGGATTCTCCACAGTTTTCCTCGTGCGTACT
CACGGTGGAATCCGATGTGCATTGAAGCGAATGTATGTCAATAACATGCCAGACCTCAATGTTTGTAAAA
GGGAAATTACAATTATGAAAGAGCTATCTGGTCACAAAAATATTGTGGGCTATTTGGACTGTGCTGTTAA
TTCAATTAGTGATAATGTATGGGAAGTCCTTATCTTAATGGAATATTGTCGAGCTGGACAGGTAGTGAAT
CAAATGAATAAGAAGCTACAGACGGGTTTTACAGAACCAGAAGTGTTACAGATATTCTGTGATACCTGTG
AAGCTGTTGCAAGGTTGCATCAGTGTAAGACTCCAATAATTCACCGGGATCTGAAGGTAGAAAATATTTT
GTTGAATGATGGTGGGAACTATGTACTTTGTGACTTTGGCAGTGCCACTAATAAATTTCTTAATCCTCAA
AAAGATGGAGTTAATGTAGTAGAAGAAGAAATTAAAAAGTATACAACTCTGTCATACAGAGCCCCTGAAA
TGATCAACCTTTATGGAGGGAAACCCATCACCACCAAGGCTGATATCTGGGCACTGGGATGTCTACTCTA
TAAACTTTGTTTCTTCACTCTTCCTTTTGGTGAGAGTCAGGTTGCTATCTGTGATGGCAACTTCACCATC
CCAGACAATTCTCGTTACTCCCGTAACATACATTGCTTAATAAGGTTCATGCTTGAACCAGATCCGGAAC
ATAGACCTGATATATTTCAAGTGTCATATTTTGCATTTAAATTTGCCAAAAAGGATTGTCCAGTCTCCAA
CATCAATAATTCTTCTATTCCTTCAGCTCTTCCTGAACCGATGACTGCTAGTGAAGCAGCTGCTAGGAAA
AGCCAAATAAAAGCCAGAATAACAGATACCATTGGACCAACAGAAACCTCAATTGCACCAAGACAAAGAC
CAAAGGCCAACTCTGCTACTACTGCCACTCCCAGTGTGCTGACCATTCAAAGTTCAGCAACACCTGTTAA
AGTCCTTGCTCCTGGTGAATTCGGTAACCATAGACCAAAAGGGGCACTAAGACCTGGAAATGGCCCTGAA
ATTTTATTGGGTCAGGGACCTCCTCAGCAGCCGCCACAGCAGCATAGAGTACTCCAGCAACTACAGCAGG
GAGATTGGAGATTACAGCAACTCCATTTACAGCATCGTCATCCTCACCAGCAGCAGCAGCAGCAGCAGCA
GCAACAGCAACAGCAGCAGCAGCAACAGCAACAGCAGCAGCAGCAGCAGCAGCAGCAGCACCACCACCAC
CACCACCACCACCTACTTCAAGATGCTTATATGCAGCAGTATCAACATGCAACACAGCAGCAACAGATGC
TTCAACAACAATTTTTAATGCATTCGGTATATCAACCACAACCTTCTGCATCACAGTATCCTACAATGAT
GCCGCAGTATCAGCAGGCTTTCTTTCAACAGCAGATGCTAGCTCAACATCAGCCGTCTCAACAACAGGCA
TCACCTGAATATCTTACCTCCCCTCAAGAGTTCTCACCAGCCTTAGTTTCCTACACTTCATCACTTCCAG
CTCAGGTTGGAACCATAATGGACTCCTCCTATAGTGCCAATAGGTCAGTTGCTGATAAAGAGGCCATTGC
AAATTTCACAAATCAGAAGAACATCAGCAATCCACCTGATATGTCAGGGTGGAATCCTTTTGGAGAGGAT
AATTTCTCTAAGTTAACAGAAGAGGAACTATTGGACAGAGAATTTGACCTTCTAAGATCAAATAGGCTCG
AGGAGAGAGCATCCTCAGATAAGAATGTAGACTCACTTTCTGCTCCACATAACCATCCTCCAGAAGATCC
TTTTGGTTCTGTTCCTTTCATTTCTCATTCAGGTTCTCCTGAAAAGAAAGCTGAACATTCATCTATAAAT
CAAGAAAATGGCACTGCAAACCCTATCAAGAACGGTAAAACAAGTCCAGCATCTAAAGATCAGCGGACTG
GAAAGAAAACCTCAGTACAGGGTCAAGTGCAAAAGGGGAATGATGAATCTGAAAGTGATTTTGAATCAGA
TCCCCCTTCTCCTAAGAGCAGTGAAGAGGAAGAGCAAGATGATGAAGAAGTTCTTCAGGGGGAACAAGGA
GATTTTAATGATGATGATACTGAACCAGAAAATCTGGGTCATAGGCCTCTCCTCATGGATTCTGAAGATG
AGGAAGAAGAGGAGAAACATAGCTCTGATTCTGATTATGAGCAGGCTAAAGCAAAGTACAGTGACATGAG
CTCTGTCTACAGAGACAGATCTGGCAGTGGACCAACCCAAGATCTTAATACAATACTCCTCACCTCAGCC
CAATTATCCTCTGATGTTGCAGTGGAGACTCCCAAACAGGAGTTTGATGTATTTGGCGCTGTCCCCTTCT
TTGCAGTGCGTGCTCAACAGCCCCAGCAAGAAAAGAATGAAAAGAACCTCCCTCAACACAGGTTTCCTGC
TGCAGGACTGGAGCAGGAGGAATTTGATGTATTCACAAAGGCGCCTTTTAGCAAGAAGGTGAATGTACAA
GAATGCCATGCAGTGGGGCCTGAGGCACATACTATCCCTGGTTATCCCAAAAGTGTAGATGTATTTGGCT
CCACTCCATTTCAGCCCTTCCTCACATCAACAAGTAAAAGTGAAAGCAATGAGGACCTTTTTGGGCTTGT
GCCCTTTGATGAAATAACGGGGAGCCAGCAGCAAAAAGTCAAACAGCGCAGCTTACAGAAACTGTCCTCT
CGCCAAAGGCGCACAAAGCAGGATATGTCCAAAAGTAATGGGAAGCGGCATCATGGCACGCCAACTAGCA
CAAAGAAGACTTTGAAGCCTACCTATCGCACTCCAGAGAGGGCTCGCAGGCACAAAAAAGTGGGCCGCCG
AGACTCTCAAAGTAGCAATGAATTTTTAACCATCTCAGACTCCAAGGAGAACATTAGTGTTGCACTGACT
GATGGGAAAGATAGGGGGAATGTCTTACAACCTGAGGAGAGCCTGTTGGACCCCTTCGGTGCCAAGCCCT
TCCATTCTCCAGACCTGTCATGGCACCCTCCACATCAGGGCCTGAGCGACATCCGTGCTGATCACAATAC
TGTCCTGCCAGGGCGGCCAAGACAAAATTCACTACATGGGTCATTCCATAGTGCAGATGTATTGAAAATG
GATGATTTTGGTGCCGTGCCCTTTACAGAACTTGTGGTGCAAAGCATCACTCCACATCAGTCCCAACAGT
CCCAACCAGTCGAATTAGACCCATTTGGTGCTGCTCCATTTCCTTCTAAACAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215795 representing NM_198892
Red=Cloning site Green=Tags(s)

MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEGGFSTVFLVRT
HGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSISDNVWEVLILMEYCRAGQVVN
QMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLNDGGNYVLCDFGSATNKFLNPQ
KDGVNVVEEEIKKYTTLSYRAPEMINLYGGKPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTI
PDNSRYSRNIHCLIRFMLEPDPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARK
SQIKARITDTIGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQQQQQQQHHHH
HHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQYQQAFFQQQMLAQHQPSQQQA
SPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSVADKEAIANFTNQKNISNPPDMSGWNPFGED
NFSKLTEEELLDREFDLLRSNRLEERASSDKNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSIN
QENGTANPIKNGKTSPASKDQRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQG
DFNDDDTEPENLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTKAPFSKKVNVQ
ECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFDEITGSQQQKVKQRSLQKLSS
RQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARRHKKVGRRDSQSSNEFLTISDSKENISVALT
DGKDRGNVLQPEESLLDPFGAKPFHSPDLSWHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKM
DDFGAVPFTELVVQSITPHQSQQSQPVELDPFGAAPFPSKQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_198892
ORF Size 3483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_198892.1, NP_942595.1
RefSeq Size 3859 bp
RefSeq ORF 3486 bp
Locus ID 55589
UniProt ID Q9NSY1
Cytogenetics 4q21.21
Protein Families Druggable Genome, Protein Kinase
MW 129 kDa
Gene Summary This gene is the human homolog of mouse BMP-2-inducible kinase. Bone morphogenic proteins (BMPs) play a key role in skeletal development and patterning. Expression of the mouse gene is increased during BMP-2 induced differentiation and the gene product is a putative serine/threonine protein kinase containing a nuclear localization signal. Therefore, the protein encoded by this human homolog is thought to be a protein kinase with a putative regulatory role in attenuating the program of osteoblast differentiation. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.