SLC6A20 (NM_020208) Human Tagged ORF Clone

CAT#: RC215764

Reviews ()
Write a review

SLC6A20 (Myc-DDK-tagged)-Human solute carrier family 6 (proline IMINO transporter), member 20 (SLC6A20), transcript variant 1



  "NM_020208" in other vectors (4)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 544.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC6A20
Synonyms IMINO; SIT1; XT3; Xtrp3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215764 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAAAGCGCGGCCGCTGTGGGCCAACTCGCTACAGTTCGTGTTCGCCTGCATCTCGTACGCCGTGG
GCCTGGGCAACGTGTGGCGATTCCCGTACCTGTGCCAGATGTACGGCGGAGGTAGTTTCCTGGTCCCCTA
CATCATCATGCTTATCGTGGAGGGAATGCCGCTCTTGTACCTGGAACTGGCTGTGGGGCAGCGCATGCGG
CAGGGCAGCATCGGCGCCTGGAGGACCATCAGCCCGTACCTCAGTGGTGTCGGGGTCGCCAGCGTGGTGG
TCTCTTTCTTCCTCTCCATGTACTACAACGTCATCAACGCCTGGGCCTTCTGGTACCTCTTCCACTCCTT
CCAGGATCCCCTGCCGTGGTCTGTCTGCCCACTGAATGGTAACCACACGGGCTACGATGAGGAGTGCGAG
AAGGCGTCCTCCACACAGTACTTCTGGTACAGGAAAACCCTCAATATCTCGCCGTCCCTCCAGGAGAACG
GGGGTGTGCAGTGGGAGCCGGCGCTGTGCCTCCTCCTGGCCTGGCTGGTGGTGTACCTGTGCATCCTGCG
TGGCACCGAGTCCACTGGCAAGGTGGTGTATTTCACGGCGTCACTGCCCTATTGCGTGCTCATCATCTAC
CTCATCAGGGGCCTCACGCTCCACGGAGCCACCAATGGCCTCATGTACATGTTCACTCCCAAGATAGAGC
AGCTGGCCAACCCCAAGGCCTGGATCAATGCAGCCACCCAGATCTTCTTCTCACTTGGCCTGGGCTTCGG
CAGCCTGATCGCCTTCGCCAGCTACAATGAGCCATCCAACAACTGCCAGAAGCACGCCATCATCGTGTCC
CTCATCAACAGCTTCACCTCCATATTTGCCAGCATTGTCACCTTCTCCATCTATGGCTTCAAGGCCACCT
TCAATTATGAAAACTGCTTGAAGAAGGTGAGTCTGCTGCTGACCAACACTTTTGACCTTGAAGATGGCTT
TTTGACAGCCAGCAACCTGGAGCAGGTGAAGGGCTACCTCGCATCTGCCTACCCAAGCAAATACAGCGAG
ATGTTCCCGCAAATCAAAAACTGCAGCTTGGAATCGGAGCTAGACACGGCCGTCCAGGGCACTGGCCTGG
CATTCATCGTCTATACAGAGGCCATTAAAAACATGGAGGTGTCCCAGCTGTGGTCGGTGCTCTACTTCTT
CATGCTGCTGATGCTGGGCATTGGGAGCATGCTGGGGAACACAGCGGCCATCCTCACCCCTCTGACAGAC
AGCAAGATCATCTCCAGCCACCTGCCCAAGGAGGCCATCTCAGGTCTGGTGTGCCTTGTCAACTGTGCCA
TTGGCATGGTGTTCACGATGGAGGCTGGGAACTACTGGTTTGACATATTCAACGACTACGCGGCCACACT
GTCCCTGCTGCTCATCGTGCTGGTGGAGACGATTGCCGTGTGCTACGTGTACGGGCTGAGGAGATTTGAA
AGTGACCTTAAGGCCATGACCGGCCGAGCTGTGAGCTGGTACTGGAAGGTGATGTGGGCTGGCGTAAGCC
CACTGCTGATTGTCAGCCTCTTTGTCTTCTACCTGAGCGACTACATCCTCACGGGGACCCTGAAGTATCA
AGCCTGGGACGCCTCCCAGGGCCAGCTCGTGACCAAAGATTACCCGGCCTATGCACTGGCTGTCATCGGG
CTGCTTGTGGCCTCCTCCACCATGTGCATCCCCCTGGCGGCCCTGGGGACTTTTGTTCAGCGTCGCCTCA
AGAGGGGAGACGCAGACCCCGTGGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215764 protein sequence
Red=Cloning site Green=Tags(s)

MEKARPLWANSLQFVFACISYAVGLGNVWRFPYLCQMYGGGSFLVPYIIMLIVEGMPLLYLELAVGQRMR
QGSIGAWRTISPYLSGVGVASVVVSFFLSMYYNVINAWAFWYLFHSFQDPLPWSVCPLNGNHTGYDEECE
KASSTQYFWYRKTLNISPSLQENGGVQWEPALCLLLAWLVVYLCILRGTESTGKVVYFTASLPYCVLIIY
LIRGLTLHGATNGLMYMFTPKIEQLANPKAWINAATQIFFSLGLGFGSLIAFASYNEPSNNCQKHAIIVS
LINSFTSIFASIVTFSIYGFKATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSE
MFPQIKNCSLESELDTAVQGTGLAFIVYTEAIKNMEVSQLWSVLYFFMLLMLGIGSMLGNTAAILTPLTD
SKIISSHLPKEAISGLVCLVNCAIGMVFTMEAGNYWFDIFNDYAATLSLLLIVLVETIAVCYVYGLRRFE
SDLKAMTGRAVSWYWKVMWAGVSPLLIVSLFVFYLSDYILTGTLKYQAWDASQGQLVTKDYPAYALAVIG
LLVASSTMCIPLAALGTFVQRRLKRGDADPVA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_020208
ORF Size 1776 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_020208.4
RefSeq Size 5455 bp
RefSeq ORF 1779 bp
Locus ID 54716
UniProt ID Q9NP91
Cytogenetics 3p21.31
Protein Families Druggable Genome, Transmembrane
MW 65.9 kDa
Gene Summary Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene belongs to the sodium:neurotransmitter symporter (SNF) family and functions as a proline transporter expressed in kidney and small intestine. Mutations in this gene are associated with Hyperglycinuria and Iminoglycinuria. [provided by RefSeq, Jul 2020]

Other Versions

Other products for "SLC6A20"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


SLC6A20 Antibody - C-terminal region
    • 100 ul

USD 475.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.