BMP10 (NM_014482) Human Tagged ORF Clone

CAT#: RC215695

BMP10 (Myc-DDK-tagged)-Human bone morphogenetic protein 10 (BMP10)

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name BMP10 (NM_014482) Human Tagged ORF Clone
Symbol BMP10
Synonyms MGC126783
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215695 representing NM_014482
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCTCTCTGGTCCTGACACTGTGCGCTCTTTTCTGCCTGGCAGCTTACTTGGTTTCTGGCAGCCCCA
TCATGAACCTAGAGCAGTCTCCTCTGGAAGAAGATATGTCCCTCTTTGGTGATGTTTTCTCAGAGCAAGA
CGGTGTCGACTTTAACACACTGCTCCAGAGCATGAAGGATGAGTTTCTTAAGACACTAAACCTCTCTGAC
ATCCCCACGCAGGATTCAGCCAAGGTGGACCCACCAGAGTACATGTTGGAACTCTACAACAAATTTGCAA
CAGATCGGACCTCCATGCCCTCTGCCAACATCATTAGGAGTTTCAAGAATGAAGATCTGTTTTCCCAGCC
GGTCAGTTTTAATGGGCTCCGAAAATACCCCCTCCTCTTCAATGTGTCCATTCCTCACCATGAAGAGGTC
ATCATGACTGAACTTAGGCTATACACACTGGTGCAAAGGGATCGTATGATATACGATGGAGTAGACCGGA
AAATTACCATTTTTGAAGTGCTGGAGAGCAAAGGGGATAATGAGGGAGAAAGAAACATGCTGGTCTTGGT
GTCTGGGGAGATATATGGAACCAACAGTGAGTGGGAGACTTTTGATGTCACAGATGCCATCAGACGTTGG
CAAAAGTCAGGCTCATCCACCCACCAGCTGGAGGTCCACATTGAGAGCAAACACGATGAAGCTGAGGATG
CCAGCAGTGGACGGCTAGAAATAGATACCAGTGCCCAGAATAAGCATAACCCTTTGCTCATCGTGTTTTC
TGATGACCAAAGCAGTGACAAGGAGAGGAAGGAGGAACTGAATGAAATGATTTCCCATGAGCAACTTCCA
GAGCTGGACAACTTGGGCCTGGATAGCTTTTCCAGTGGACCTGGGGAAGAGGCTTTGTTGCAGATGAGAT
CAAACATCATCTATGACTCCACTGCCCGAATCAGAAGGAACGCCAAAGGAAACTACTGTAAGAGGACCCC
GCTCTACATCGACTTCAAGGAGATTGGGTGGGACTCCTGGATCATCGCTCCGCCTGGATACGAAGCCTAT
GAATGCCGTGGTGTTTGTAACTACCCCCTGGCAGAGCATCTCACACCCACAAAGCATGCAATTATCCAGG
CCTTGGTCCACCTCAAGAATTCCCAGAAAGCTTCCAAAGCCTGCTGTGTGCCCACAAAGCTAGAGCCCAT
CTCCATCCTCTATTTAGACAAAGGCGTCGTCACCTACAAGTTTAAATACGAAGGCATGGCCGTCTCCGAA
TGTGGCTGTAGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215695 representing NM_014482
Red=Cloning site Green=Tags(s)

MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSD
IPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEV
IMTELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRW
QKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLP
ELDNLGLDSFSSGPGEEALLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAY
ECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSE
CGCR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014482
ORF Size 1272 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014482.1, NM_014482.2, NP_055297
RefSeq Size 1584
RefSeq ORF 1275
Locus ID 27302
Cytogenetics 2p13.3
Protein Families Secreted Protein, Transmembrane, Druggable Genome
MW 48.08 kDa
Gene Summary This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development including cardiomyocyte proliferation and regulation of heart size, closure of the ductus arteriosus, angiogenesis and ventricular trabeculation. [provided by RefSeq, Aug 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)