PANK2 (NM_153638) Human Tagged ORF Clone

CAT#: RC215676

Reviews ()
Write a review

PANK2 (Myc-DDK-tagged)-Human pantothenate kinase 2 (PANK2), nuclear gene encoding mitochondrial protein, transcript variant 1



Reconstitution Protocol

USD 531.00

In Stock*

Size
    • 10 ug

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PANK2"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PANK2
Synonyms C20orf48; HARP; HSS; NBIA1; PKAN
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215676 representing NM_153638
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGAGGCTCGGGCCCTTCCACCCACGCGTCCATTGGGCGGCGCCGCCATCACTCTCTTCTGGGCTAC
ACCGCCTTCTCTTCCTCCGCGGAACCCGGATCCCCTCCTCCACCACCCTCTCCCCGCCCCGTCACGATAG
CCTCTCATTGGACGGAGGCACGGTCAATCCTCCTCGAGTTAGGGAGCCGACTGGACGCGAGGCCTTTGGG
CCGTCCCCAGCCTCGTCGGATTGGCTTCCTGCGCGTTGGCGCAACGGAAGAGGCGGCCGGCCGAGGGCGC
GCCTCTGCTCTGGCTGGACTGCCGCGGAGGAGGCGAGAAGGAATCCGACGCTGGGGGGCTTGCTCGGGCG
GCAGCGACTGCTGCTGCGGATGGGAGGGGGCCGGCTCGGCGCGCCCATGGAGCGCCACGGCAGGGCTTCC
GCCACCTCCGTCTCGTCGGCTGGGGAGCAGGCGGCCGGGGACCCCGAAGGGCGGCGGCAGGAGCCACTGC
GGCGCCGGGCGAGCAGCGCGTCGGTGCCCGCGGTCGGGGCCTCGGCTGAGGGCACGAGGCGGGATCGACT
GGGCTCTTACAGCGGCCCCACCTCGGTCTCCCGCCAGCGCGTCGAAAGCCTGAGGAAAAAGCGGCCGCTT
TTTCCATGGTTTGGACTGGATATCGGTGGAACTCTGGTCAAGCTGGTATATTTTGAACCCAAAGACATCA
CTGCTGAAGAAGAAGAGGAAGAAGTGGAAAGTCTTAAAAGCATTCGGAAGTACCTGACCTCCAATGTGGC
TTATGGGTCTACAGGCATTCGGGACGTGCACCTCGAGCTGAAGGACCTGACTCTGTGTGGACGCAAAGGC
AATCTGCACTTTATACGCTTTCCCACTCATGACATGCCTGCTTTTATTCAAATGGGCAGAGATAAAAACT
TCTCGAGTCTCCACACTGTCTTTTGTGCCACTGGAGGTGGAGCGTACAAATTTGAGCAGGATTTTCTCAC
AATAGGTGATCTTCAGCTTTGCAAACTGGATGAACTAGATTGCTTGATCAAAGGAATTTTATACATTGAC
TCAGTCGGATTCAATGGACGGTCACAGTGCTATTACTTTGAAAACCCTGCTGATTCTGAAAAGTGTCAGA
AGTTACCATTTGATTTGAAAAATCCGTATCCTCTGCTTCTGGTGAACATTGGCTCAGGGGTTAGCATCTT
AGCAGTATATTCCAAAGATAATTACAAACGGGTCACAGGTACTAGTCTTGGAGGAGGAACTTTTTTTGGT
CTCTGCTGTCTTCTTACTGGCTGTACCACTTTTGAAGAAGCTCTTGAAATGGCATCTCGTGGAGATAGCA
CCAAAGTGGATAAACTAGTACGAGATATTTATGGAGGGGACTATGAGAGGTTTGGACTGCCAGGCTGGGC
TGTGGCTTCAAGCTTTGGAAACATGATGAGCAAGGAGAAGCGAGAGGCTGTCAGTAAAGAGGACCTGGCC
AGAGCGACTTTGATCACCATCACCAACAACATTGGCTCAATAGCAAGAATGTGTGCCCTTAATGAAAACA
TTAACCAGGTGGTATTTGTTGGAAATTTCTTGAGAATTAATACGATCGCCATGCGGCTTTTGGCATATGC
TTTGGATTATTGGTCCAAGGGGCAGTTGAAAGCACTTTTTTCGGAACACGAGGGTTATTTTGGAGCTGTT
GGAGCACTCCTTGAGCTGTTGAAGATCCCG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC215676 representing NM_153638
Red=Cloning site Green=Tags(s)

MRRLGPFHPRVHWAAPPSLSSGLHRLLFLRGTRIPSSTTLSPPRHDSLSLDGGTVNPPRVREPTGREAFG
PSPASSDWLPARWRNGRGGRPRARLCSGWTAAEEARRNPTLGGLLGRQRLLLRMGGGRLGAPMERHGRAS
ATSVSSAGEQAAGDPEGRRQEPLRRRASSASVPAVGASAEGTRRDRLGSYSGPTSVSRQRVESLRKKRPL
FPWFGLDIGGTLVKLVYFEPKDITAEEEEEEVESLKSIRKYLTSNVAYGSTGIRDVHLELKDLTLCGRKG
NLHFIRFPTHDMPAFIQMGRDKNFSSLHTVFCATGGGAYKFEQDFLTIGDLQLCKLDELDCLIKGILYID
SVGFNGRSQCYYFENPADSEKCQKLPFDLKNPYPLLLVNIGSGVSILAVYSKDNYKRVTGTSLGGGTFFG
LCCLLTGCTTFEEALEMASRGDSTKVDKLVRDIYGGDYERFGLPGWAVASSFGNMMSKEKREAVSKEDLA
RATLITITNNIGSIARMCALNENINQVVFVGNFLRINTIAMRLLAYALDYWSKGQLKALFSEHEGYFGAV
GALLELLKIP

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_153638
ORF Size 1710 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_153638.3, NP_705902.2
RefSeq Size 2280 bp
RefSeq ORF 1713 bp
Locus ID 80025
UniProt ID Q9BZ23
Cytogenetics 20p13
Protein Families Druggable Genome
Protein Pathways Metabolic pathways, Pantothenate and CoA biosynthesis
MW 59.1 kDa
Gene Summary This gene encodes a protein belonging to the pantothenate kinase family and is the only member of that family to be expressed in mitochondria. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells. It catalyzes the first committed step in the universal biosynthetic pathway leading to CoA and is itself subject to regulation through feedback inhibition by acyl CoA species. Mutations in this gene are associated with HARP syndrome and pantothenate kinase-associated neurodegeneration (PKAN), formerly Hallervorden-Spatz syndrome. Alternative splicing, involving the use of alternate first exons, results in multiple transcripts encoding different isoforms. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.