DACT1(DACT1) (NM_001079520) Human Tagged ORF Clone

CAT#: RC215557

DACT1 (Myc-DDK-tagged)-Human dapper, antagonist of beta-catenin, homolog 1 (Xenopus laevis) (DACT1), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,216.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DACT1(DACT1) (NM_001079520) Human Tagged ORF Clone
Symbol DACT1
Synonyms DAPPER; DAPPER1; DPR1; FRODO; HDPR1; THYEX3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215557 representing NM_001079520
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCCGAGTCCGGCCGGGACGGCGAAGGAGCTGGAGCCTCCGGCGCCGGCCCGAGGCGAGCAGCGCA
CGGCGGAGCCCGAGGGGCGCTGGCGGGAGAAGGGCGAGGCAGACACCGAGCGGCAGCGCACCCGGGAGCG
GCAGGAGGCCACGCTGGCCGGGCTGGCGGAGCTGGAGTACCTGCGCCAGCGCCAAGAGCTGCTGGTCAGG
GGCGCCCTGCGCGGCGCCGGGGGTGCGGGAGCCGCTGCGCCCCGCGCTGGGGAGCTACTGGGGGAGGCGG
CGCAGCGCAGTCGCCTGGAGGAGAAGTTCTTGGAGGAGAACATCTTGCTGCTAAGAAAGCAATTGAACTG
TTTGAGGCGAAGAGATGCTGGTTTGTTGAATCAGTTGCAAGAGCTTGACAAGCAGATAAGTGACCTGAGA
CTGGATGTAGAAAAGACATCTGAAGAGCACCTGGAGACAGACAGTCGGCCTAGCTCAGGGTTTTATGAGC
TGAGTGATGGGGCTTCAGGATCCCTTTCCAATTCCTCTAACTCGGTGTTCAGTGAGTGTTTATCCAGTTG
TCATTCCAGCACCTGCTTTTGCAGCCCCTTGGAGGCGACCTTGAGTCTCTCAGATGGTTGCCCCAAATCT
GCAGATGTGAATCCCAAGTACCAGTGTGATCTGGTGTCTAAAAACGGGAATGATGTATATCGCTATCCCA
GTCCACTTCATGCTGTGGCTGTGCAGAGCCCAATGTTTCTCCTTTGTCTGACGGGCAACCCTCTGAGGGA
AGAGGACAGGCTTGGAAACCATGCCAGTGACATTTGCGGTGGATCTGAGCTAGATGCCGTCAAAACAGAC
AGTTCCTTACCGTCCCCAAGCAGTCTGTGGTCTGCTTCCCATCCTTCATCCAGCAAGAAAATGGATGGCT
ACATTCTGAGCCTGGTCCAGAAAAAAACACACCCTGTAAGGACCAACAAACCAAGAACCAGCGTGAACGC
TGACCCCACGAAAGGGCTTCTGAGGAACGGGAGCGTTTGTGTCAGAGCCCCGGGCGGTGTCTCACAGGGC
AACAGTGTGAACCTTAAGAATTCGAAACAGGCGTGTCTGCCCTCTGGCGGGATACCTTCTCTGAACAATG
GGACATTCTCCCCACCGAAGCAGTGGTCGAAAGAATCAAAGGCCGAACAAGCCGAAAGCAAGAGGGTGCC
CCTGCCAGAGGGCTGCCCCTCAGGCGCTGCCTCCGACCTTCAGAGTAAGCACCTGCCAAAAACGGCCAAG
CCAGCCTCGCAAGAACATGCTCGGTGTTCCGCCATTGGGACAGGGGAGTCCCCTAAGGAAAGCGCTCAGC
TCTCAGGGGCCTCTCCAAAAGAGAGTCCTAGCAGAGGCCCTGCCCCGCCGCAGGAGAACAAAGTTGTACA
GCCCCTGAAAAAGATGTCACAGAAAAACAGCCTGCAGGGCGTCCCCCCGGCCACTCCTCCCCTGCTGTCT
ACAGCTTTCCCCGTGGAAGAGAGGCCTGCCTTGGATTTCAAGAGCGAGGGCTCTTCCCAAAGCCTGGAGG
AAGCGCACCTGGTCAAGGCCCAGTTTATCCCGGGGCAGCAGCCCAGTGTCAGGCTCCACCGGGGCCACAG
GAACATGGGCGTCGTGAAGAACTCCAGCCTGAAGCACCGCGGCCCAGCCCTCCAGGGGCTGGAGAACGGC
TTGCCCACCGTCAGGGAGAAAACGCGGGCCGGGAGCAAGAAGTGTCGCTTCCCAGATGACTTGGATACAA
ATAAGAAACTCAAGAAAGCCTCCTCCAAGGGGAGGAAGAGTGGGGGCGGGCCCGAGGCTGGTGTTCCCGG
CAGGCCCGCGGGCGGGGGCCACAGGGCGGGGAGCAGGGCGCATGGCCACGGACGGGAGGCGGTGGTGGCC
AAACCTAAGCACAAGCGAACTGACTACCGGCGGTGGAAGTCCTCGGCCGAGATTTCCTACGAAGAGGCCC
TGAGGAGGGCCCGGCGCGGTCGCCGGGAGAATGTGGGGCTGTACCCCGCGCCTGTGCCTCTGCCCTACGC
CAGCCCCTACGCCTACGTGGCTAGCGACTCCGAGTACTCGGCCGAGTGCGAGTCCCTGTTCCACTCCACC
GTGGTGGACACCAGTGAGGACGAGCAGAGCAATTACACCACCAACTGCTTCGGGGACAGCGAGTCGAGTG
TGAGCGAGGGCGAGTTCGTGGGGGAGAGCACAACCACCAGCGACTCTGAAGAAAGCGGGGGCTTAATTTG
GTCCCAGTTTGTCCAGACTCTGCCCATTCAAACGGTAACGGCCCCAGACCTTCACAACCACCCCGCAAAA
ACCTTTGTCAAAATTAAGGCCTCACATAACCTCAAGAAGAAGATCCTCCGCTTTCGGTCTGGCTCTTTGA
AACTGATGACGACGGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215557 representing NM_001079520
Red=Cloning site Green=Tags(s)

MKPSPAGTAKELEPPAPARGEQRTAEPEGRWREKGEADTERQRTRERQEATLAGLAELEYLRQRQELLVR
GALRGAGGAGAAAPRAGELLGEAAQRSRLEEKFLEENILLLRKQLNCLRRRDAGLLNQLQELDKQISDLR
LDVEKTSEEHLETDSRPSSGFYELSDGASGSLSNSSNSVFSECLSSCHSSTCFCSPLEATLSLSDGCPKS
ADVNPKYQCDLVSKNGNDVYRYPSPLHAVAVQSPMFLLCLTGNPLREEDRLGNHASDICGGSELDAVKTD
SSLPSPSSLWSASHPSSSKKMDGYILSLVQKKTHPVRTNKPRTSVNADPTKGLLRNGSVCVRAPGGVSQG
NSVNLKNSKQACLPSGGIPSLNNGTFSPPKQWSKESKAEQAESKRVPLPEGCPSGAASDLQSKHLPKTAK
PASQEHARCSAIGTGESPKESAQLSGASPKESPSRGPAPPQENKVVQPLKKMSQKNSLQGVPPATPPLLS
TAFPVEERPALDFKSEGSSQSLEEAHLVKAQFIPGQQPSVRLHRGHRNMGVVKNSSLKHRGPALQGLENG
LPTVREKTRAGSKKCRFPDDLDTNKKLKKASSKGRKSGGGPEAGVPGRPAGGGHRAGSRAHGHGREAVVA
KPKHKRTDYRRWKSSAEISYEEALRRARRGRRENVGLYPAPVPLPYASPYAYVASDSEYSAECESLFHST
VVDTSEDEQSNYTTNCFGDSESSVSEGEFVGESTTTSDSEESGGLIWSQFVQTLPIQTVTAPDLHNHPAK
TFVKIKASHNLKKKILRFRSGSLKLMTTV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001079520
ORF Size 2397 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001079520.1, NP_001072988
RefSeq Size 3766
RefSeq ORF 2400
Locus ID 51339
Cytogenetics 14q23.1
MW 86.2 kDa
Gene Summary The protein encoded by this gene belongs to the dapper family, characterized by the presence of PDZ-binding motif at the C-terminus. It interacts with, and positively regulates dishevelled-mediated signaling pathways during development. Depletion of this mRNA from xenopus embryos resulted in loss of notochord and head structures, and mice lacking this gene died shortly after birth from severe posterior malformations. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jan 2012].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations