GABA B Receptor 1 (GABBR1) (NM_021904) Human Tagged ORF Clone

CAT#: RC215515

Reviews ()
Write a review

GABBR1 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) B receptor, 1 (GABBR1), transcript variant 3



Reconstitution Protocol

USD 823.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "GABBR1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GABBR1
Synonyms GABABR1; GABBR1-3; GB1; GPRC3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215515 representing NM_021904
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCTGCTGCTGCTACTGGCGCCACTCTTCCTCCGCCCCCCGGGCGCGGGCGGGGCGCAGACCCCCA
ACGCCACCTCAGAAGGTTGCCAGATCATACACCCGCCCTGGGAAGGGGGCATCAGGTACCGGGGCCTGAC
TCGGGACCAGGTGAAGGCTATCAACTTCCTGCCAGTGGACTATGAGATTGAGTATGTGTGCCGGGGGGAG
CGCGAGGTGGTGGGGCCCAAGGTCCGCAAGTGCCTGGCCAACGGCTCCTGGACAGATATGGACACACCCA
GCCGCTGTGTGAATCGAACGCCACACTCAGAACGGCGCGCAGTGTACATCGGGGCACTGTTTCCCATGAG
CGGGGGCTGGCCAGGGGGCCAGGCCTGCCAGCCCGCGGTGGAGATGGCGCTGGAGGACGTGAATAGCCGC
AGGGACATCCTGCCGGACTATGAGCTCAAGCTCATCCACCACGACAGCAAGTGTGATCCAGGCCAAGCCA
CCAAGTACCTATATGAGCTGCTCTACAACGACCCTATCAAGATCATCCTTATGCCTGGCTGCAGCTCTGT
CTCCACGCTGGTGGCTGAGGCTGCTAGGATGTGGAACCTCATTGTGCTTTCCTATGGCTCCAGCTCACCA
GCCCTGTCAAACCGGCAGCGTTTCCCCACTTTCTTCCGAACGCACCCATCAGCCACACTCCACAACCCTA
CCCGCGTGAAACTCTTTGAAAAGTGGGGCTGGAAGAAGATTGCTACCATCCAGCAGACCACTGAGGTCTT
CACTTCGACTCTGGACGACCTGGAGGAACGAGTGAAGGAGGCTGGAATTGAGATTACTTTCCGCCAGAGT
TTCTTCTCAGATCCAGCTGTGCCCGTCAAAAACCTGAAGCGCCAGGATGCCCGAATCATCGTGGGACTTT
TCTATGAGACTGAAGCCCGGAAAGTTTTTTGTGAGGTGTACAAGGAGCGTCTCTTTGGGAAGAAGTACGT
CTGGTTCCTCATTGGGTGGTATGCTGACAATTGGTTCAAGATCTACGACCCTTCTATCAACTGCACAGTG
GATGAGATGACTGAGGCGGTGGAGGGCCACATCACAACTGAGATTGTCATGCTGAATCCTGCCAATACCC
GCAGCATTTCCAACATGACATCCCAGGAATTTGTGGAGAAACTAACCAAGCGACTGAAAAGACACCCTGA
GGAGACAGGAGGCTTCCAGGAGGCACCGCTGGCCTATGATGCCATCTGGGCCTTGGCACTGGCCCTGAAC
AAGACATCTGGAGGAGGCGGCCGTTCTGGTGTGCGCCTGGAGGACTTCAACTACAACAACCAGACCATTA
CCGACCAAATCTACCGGGCAATGAACTCTTCGTCCTTTGAGGGTGTCTCTGGCCATGTGGTGTTTGATGC
CAGCGGCTCTCGGATGGCATGGACGCTTATCGAGCAGCTTCAGGGTGGCAGCTACAAGAAGATTGGCTAC
TATGACAGCACCAAGGATGATCTTTCCTGGTCCAAAACAGATAAATGGATTGGAGGGTCCCCCCCAGCTG
ACCAGACCCTGGTCATCAAGACATTCCGCTTCCTGTCACAGAAACTCTTTATCTCCGTCTCAGTTCTCTC
CAGCCTGGGCATTGTCCTAGCTGTTGTCTGTCTGTCCTTTAACATCTACAACTCACATGTCCGTTATATC
CAGAACTCACAGCCCAACCTGAACAACCTGACTGCTGTGGGCTGCTCACTGGCTTTAGCTGCTGTCTTCC
CCCTGGGGCTCGATGGTTACCACATTGGGAGGAACCAGTTCCCTTTCGTCTGCCAGGCCCGCCTCTGGCT
CCTGGGCCTGGGCTTTAGTCTGGGCTACGGTTCCATGTTCACCAAGATTTGGTGGGTCCACACGGTCTTC
ACAAAGAAGGAAGAAAAGAAGGAGTGGAGGAAGACTCTGGAACCCTGGAAGCTGTATGCCACAGTGGGCC
TGCTGGTGGGCATGGATGTCCTCACTCTCGCCATCTGGCAGATCGTGGACCCTCTGCACCGGACCATTGA
GACATTTGCCAAGGAGGAACCTAAGGAAGATATTGACGTCTCTATTCTGCCCCAGCTGGAGCATTGCAGC
TCCAGGAAGATGAATACATGGCTTGGCATTTTCTATGGTTACAAGGGGCTGCTGCTGCTGCTGGGAATCT
TCCTTGCTTATGAGACCAAGAGTGTGTCCACTGAGAAGATCAATGATCACCGGGCTGTGGGCATGGCTAT
CTACAATGTGGCAGTCCTGTGCCTCATCACTGCTCCTGTCACCATGATTCTGTCCAGCCAGCAGGATGCA
GCCTTTGCCTTTGCCTCTCTTGCCATAGTTTTCTCCTCCTATATCACTCTTGTTGTGCTCTTTGTGCCCA
AGATGCGCAGGCTGATCACCCGAGGGGAATGGCAGTCGGAGGCGCAGGACACCATGAAGACAGGGTCATC
GACCAACAACAACGAGGAGGAGAAGTCCCGGCTGTTGGAGAAGGAGAACCGTGAACTGGAAAAGATCATT
GCTGAGAAAGAGGAGCGTGTCTCTGAACTGCGCCATCAACTCCAGTCTCGGCAGCAGCTCCGCTCCCGGC
GCCACCCACCGACACCCCCAGAACCCTCTGGGGGCCTGCCCAGGGGACCCCCTGAGCCCCCCGACCGGCT
TAGCTGTGATGGGAGTCGAGTGCATTTGCTTTATAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215515 representing NM_021904
Red=Cloning site Green=Tags(s)

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE
REVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSR
RDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSP
ALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQS
FFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTV
DEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALN
KTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGY
YDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYI
QNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVF
TKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCS
SRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDA
AFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKII
AEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_021904
ORF Size 2697 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_021904.3
RefSeq Size 4260 bp
RefSeq ORF 2700 bp
Locus ID 2550
UniProt ID Q9UBS5
Cytogenetics 6p22.1
Domains 7tm_3, ANF_receptor
Protein Families Druggable Genome, GPCR, Secreted Protein, Transmembrane
Protein Pathways Neuroactive ligand-receptor interaction
MW 99.7 kDa
Gene Summary This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jan 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.