GABA B Receptor 1(GABBR1) (NM_021904) Human Tagged ORF Clone

CAT#: RC215515

GABBR1 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) B receptor, 1 (GABBR1), transcript variant 3

Change vector?

USD 1,381


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA B Receptor 1(GABBR1) (NM_021904) Human Tagged ORF Clone
Symbol GABBR1
Synonyms GABABR1; GABBR1-3; GB1; GPRC3A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215515 representing NM_021904
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCTGCTGCTGCTACTGGCGCCACTCTTCCTCCGCCCCCCGGGCGCGGGCGGGGCGCAGACCCCCA
ACGCCACCTCAGAAGGTTGCCAGATCATACACCCGCCCTGGGAAGGGGGCATCAGGTACCGGGGCCTGAC
TCGGGACCAGGTGAAGGCTATCAACTTCCTGCCAGTGGACTATGAGATTGAGTATGTGTGCCGGGGGGAG
CGCGAGGTGGTGGGGCCCAAGGTCCGCAAGTGCCTGGCCAACGGCTCCTGGACAGATATGGACACACCCA
GCCGCTGTGTGAATCGAACGCCACACTCAGAACGGCGCGCAGTGTACATCGGGGCACTGTTTCCCATGAG
CGGGGGCTGGCCAGGGGGCCAGGCCTGCCAGCCCGCGGTGGAGATGGCGCTGGAGGACGTGAATAGCCGC
AGGGACATCCTGCCGGACTATGAGCTCAAGCTCATCCACCACGACAGCAAGTGTGATCCAGGCCAAGCCA
CCAAGTACCTATATGAGCTGCTCTACAACGACCCTATCAAGATCATCCTTATGCCTGGCTGCAGCTCTGT
CTCCACGCTGGTGGCTGAGGCTGCTAGGATGTGGAACCTCATTGTGCTTTCCTATGGCTCCAGCTCACCA
GCCCTGTCAAACCGGCAGCGTTTCCCCACTTTCTTCCGAACGCACCCATCAGCCACACTCCACAACCCTA
CCCGCGTGAAACTCTTTGAAAAGTGGGGCTGGAAGAAGATTGCTACCATCCAGCAGACCACTGAGGTCTT
CACTTCGACTCTGGACGACCTGGAGGAACGAGTGAAGGAGGCTGGAATTGAGATTACTTTCCGCCAGAGT
TTCTTCTCAGATCCAGCTGTGCCCGTCAAAAACCTGAAGCGCCAGGATGCCCGAATCATCGTGGGACTTT
TCTATGAGACTGAAGCCCGGAAAGTTTTTTGTGAGGTGTACAAGGAGCGTCTCTTTGGGAAGAAGTACGT
CTGGTTCCTCATTGGGTGGTATGCTGACAATTGGTTCAAGATCTACGACCCTTCTATCAACTGCACAGTG
GATGAGATGACTGAGGCGGTGGAGGGCCACATCACAACTGAGATTGTCATGCTGAATCCTGCCAATACCC
GCAGCATTTCCAACATGACATCCCAGGAATTTGTGGAGAAACTAACCAAGCGACTGAAAAGACACCCTGA
GGAGACAGGAGGCTTCCAGGAGGCACCGCTGGCCTATGATGCCATCTGGGCCTTGGCACTGGCCCTGAAC
AAGACATCTGGAGGAGGCGGCCGTTCTGGTGTGCGCCTGGAGGACTTCAACTACAACAACCAGACCATTA
CCGACCAAATCTACCGGGCAATGAACTCTTCGTCCTTTGAGGGTGTCTCTGGCCATGTGGTGTTTGATGC
CAGCGGCTCTCGGATGGCATGGACGCTTATCGAGCAGCTTCAGGGTGGCAGCTACAAGAAGATTGGCTAC
TATGACAGCACCAAGGATGATCTTTCCTGGTCCAAAACAGATAAATGGATTGGAGGGTCCCCCCCAGCTG
ACCAGACCCTGGTCATCAAGACATTCCGCTTCCTGTCACAGAAACTCTTTATCTCCGTCTCAGTTCTCTC
CAGCCTGGGCATTGTCCTAGCTGTTGTCTGTCTGTCCTTTAACATCTACAACTCACATGTCCGTTATATC
CAGAACTCACAGCCCAACCTGAACAACCTGACTGCTGTGGGCTGCTCACTGGCTTTAGCTGCTGTCTTCC
CCCTGGGGCTCGATGGTTACCACATTGGGAGGAACCAGTTCCCTTTCGTCTGCCAGGCCCGCCTCTGGCT
CCTGGGCCTGGGCTTTAGTCTGGGCTACGGTTCCATGTTCACCAAGATTTGGTGGGTCCACACGGTCTTC
ACAAAGAAGGAAGAAAAGAAGGAGTGGAGGAAGACTCTGGAACCCTGGAAGCTGTATGCCACAGTGGGCC
TGCTGGTGGGCATGGATGTCCTCACTCTCGCCATCTGGCAGATCGTGGACCCTCTGCACCGGACCATTGA
GACATTTGCCAAGGAGGAACCTAAGGAAGATATTGACGTCTCTATTCTGCCCCAGCTGGAGCATTGCAGC
TCCAGGAAGATGAATACATGGCTTGGCATTTTCTATGGTTACAAGGGGCTGCTGCTGCTGCTGGGAATCT
TCCTTGCTTATGAGACCAAGAGTGTGTCCACTGAGAAGATCAATGATCACCGGGCTGTGGGCATGGCTAT
CTACAATGTGGCAGTCCTGTGCCTCATCACTGCTCCTGTCACCATGATTCTGTCCAGCCAGCAGGATGCA
GCCTTTGCCTTTGCCTCTCTTGCCATAGTTTTCTCCTCCTATATCACTCTTGTTGTGCTCTTTGTGCCCA
AGATGCGCAGGCTGATCACCCGAGGGGAATGGCAGTCGGAGGCGCAGGACACCATGAAGACAGGGTCATC
GACCAACAACAACGAGGAGGAGAAGTCCCGGCTGTTGGAGAAGGAGAACCGTGAACTGGAAAAGATCATT
GCTGAGAAAGAGGAGCGTGTCTCTGAACTGCGCCATCAACTCCAGTCTCGGCAGCAGCTCCGCTCCCGGC
GCCACCCACCGACACCCCCAGAACCCTCTGGGGGCCTGCCCAGGGGACCCCCTGAGCCCCCCGACCGGCT
TAGCTGTGATGGGAGTCGAGTGCATTTGCTTTATAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215515 representing NM_021904
Red=Cloning site Green=Tags(s)

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE
REVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSR
RDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSP
ALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQS
FFSDPAVPVKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTV
DEMTEAVEGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALN
KTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGY
YDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYI
QNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVF
TKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCS
SRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDA
AFAFASLAIVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKII
AEKEERVSELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021904
ORF Size 2697 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021904.1, NM_021904.2, NM_021904.3, NP_068704
RefSeq Size 4260
RefSeq ORF 2700
Locus ID 2550
Cytogenetics 6p22.1
Domains 7tm_3, ANF_receptor
Protein Families GPCR, Secreted Protein, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 99.7 kDa
Gene Summary This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations