APLP1 (NM_005166) Human Tagged ORF Clone

CAT#: RC215282

APLP1 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor-like protein 1 (APLP1), transcript variant 2

Clone Modification / Custom Cloning Service

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name APLP1 (NM_005166) Human Tagged ORF Clone
Symbol APLP1
Synonyms APLP
Vector pCMV6-Entry
Sequence Data
>RC215282 representing NM_005166
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCGCCAGCCCCGCTGCTCGCGGTCTAAGTCGCCGCCCGGGCCAGCCGCCGCTGCCGCTGCTGC
TGCCACTATTGCTGCTGCTTCTGCGCGCGCAGCCCGCCATCGGGAGCCTGGCCGGTGGGAGCCCCGGCGC
GGCCGAGGCCCCGGGGTCGGCCCAGGTGGCTGGACTATGCGGGCGCCTAACCCTTCACCGGGACCTGCGC
ACCGGCCGCTGGGAACCAGACCCACAGCGCTCTCGACGCTGTCTCCGGGACCCGCAGCGCGTGCTGGAGT
ACTGCAGACAGATGTACCCGGAGCTGCAGATTGCACGTGTGGAGCAGGCTACGCAGGCCATCCCCATGGA
GCGCTGGTGCGGGGGTTCCCGGAGCGGCAGCTGCGCCCACCCCCACCACCAGGTTGTGCCCTTCCGCTGC
CTGCCTGGTGAATTTGTGAGTGAGGCCCTGCTGGTGCCTGAAGGCTGCCGGTTCTTGCACCAGGAGCGCA
TGGACCAATGTGAGAGTTCAACCCGGAGGCATCAGGAGGCACAGGAGGCCTGCAGCTCCCAGGGCCTCAT
CCTGCACGGCTCGGGCATGCTCTTACCCTGTGGCTCGGATCGGTTCCGTGGTGTGGAGTATGTGTGCTGT
CCCCCTCCAGGGACCCCCGACCCATCTGGGACAGCAGTTGGTGACCCCTCCACCCGGTCCTGGCCCCCGG
GGAGCAGAGTAGAGGGGGCTGAGGACGAGGAAGAGGAGGAATCCTTCCCACAGCCAGTAGATGATTACTT
CGTGGAGCCTCCGCAGGCTGAAGAGGAAGAGGAAACGGTCCCACCCCCAAGCTCCCATACACTTGCAGTG
GTCGGCAAAGTCACTCCCACCCCGAGGCCCACAGACGGTGTGGATATTTACTTTGGCATGCCTGGGGAAA
TCAGTGAGCACGAGGGGTTCCTGAGGGCCAAGATGGACCTGGAGGAGCGTAGGATGCGCCAGATTAATGA
GGTGATGCGTGAATGGGCCATGGCAGACAACCAGTCCAAGAACCTGCCTAAAGCCGACAGACAGGCCCTG
AATGAGCACTTCCAGTCCATTCTGCAGACTCTGGAGGAGCAGGTGTCTGGTGAGCGACAGCGCCTGGTGG
AAACCCACGCCACCCGCGTCATCGCCCTTATCAACGACCAGCGCCGGGCTGCCTTGGAGGGCTTCCTGGC
AGCCCTGCAGGCAGATCCGCCTCAGGCGGAGCGTGTCCTGTTGGCCCTGCGGCGCTACCTGCGTGCGGAG
CAGAAGGAACAGAGGCACACGCTGCGCCACTACCAGCATGTGGCCGCCGTGGATCCCGAGAAGGCACAGC
AGATGCGCTTCCAGGTGCATACCCACCTTCAAGTGATTGAGGAGAGGGTGAATCAGAGCCTGGGCCTGCT
TGACCAGAACCCCCACCTGGCTCAGGAGCTGCGGCCCCAAATCCAGGAACTCCTCCACTCTGAACACCTG
GGTCCCAGTGAATTGGAAGCCCCTGCCCCTGGGGGCAGCAGCGAGGACAAGGGTGGGCTGCAGCCTCCAG
ATTCCAAGGATGACACCCCCATGACCCTTCCAAAAGGGTCCACAGAACAAGATGCTGCATCCCCTGAGAA
AGAGAAGATGAACCCGCTGGAACAGTATGAGCGAAAGGTGAATGCGTCTGTTCCAAGGGGTTTCCCTTTC
CACTCATCGGAGATTCAGAGGGATGAGCTGGCACCAGCTGGGACAGGGGTGTCCCGTGAGGCTGTGTCGG
GTCTGCTGATCATGGGAGCGGGCGGAGGCTCCCTCATCGTCCTCTCCATGCTGCTCCTGCGCAGGAAGAA
GCCCTACGGGGCTATCAGCCATGGCGTGGTGGAGGTGGACCCCATGCTGACCCTGGAGGAGCAGCAGCTC
CGCGAACTGCAGCGGCACGGCTATGAGAACCCCACTTACCGCTTCCTGGAGGAACGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215282 representing NM_005166
Red=Cloning site Green=Tags(s)

MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLR
TGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRC
LPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCC
PPPGTPDPSGTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAV
VGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQAL
NEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHL
GPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPF
HSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVDPMLTLEEQQL
RELQRHGYENPTYRFLEERP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005166
ORF Size 1950 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005166.1, NM_005166.2, NM_005166.3, NM_005166.4, NP_005157
RefSeq Size 2447
RefSeq ORF 1953
Locus ID 333
Cytogenetics 19q13.12
Domains A4_EXTRA
Protein Families Transmembrane, Druggable Genome
MW 72.18 kDa
Gene Summary This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)