APLP1 (NM_005166) Human Tagged ORF Clone

CAT#: RC215282

Reviews ()
Write a review

APLP1 (Myc-DDK-tagged)-Human amyloid beta (A4) precursor-like protein 1 (APLP1), transcript variant 2



  "NM_005166" in other vectors (6)

USD 480.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name APLP1 (NM_005166) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol APLP1
Synonyms APLP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC215282 representing NM_005166
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCCCGCCAGCCCCGCTGCTCGCGGTCTAAGTCGCCGCCCGGGCCAGCCGCCGCTGCCGCTGCTGC
TGCCACTATTGCTGCTGCTTCTGCGCGCGCAGCCCGCCATCGGGAGCCTGGCCGGTGGGAGCCCCGGCGC
GGCCGAGGCCCCGGGGTCGGCCCAGGTGGCTGGACTATGCGGGCGCCTAACCCTTCACCGGGACCTGCGC
ACCGGCCGCTGGGAACCAGACCCACAGCGCTCTCGACGCTGTCTCCGGGACCCGCAGCGCGTGCTGGAGT
ACTGCAGACAGATGTACCCGGAGCTGCAGATTGCACGTGTGGAGCAGGCTACGCAGGCCATCCCCATGGA
GCGCTGGTGCGGGGGTTCCCGGAGCGGCAGCTGCGCCCACCCCCACCACCAGGTTGTGCCCTTCCGCTGC
CTGCCTGGTGAATTTGTGAGTGAGGCCCTGCTGGTGCCTGAAGGCTGCCGGTTCTTGCACCAGGAGCGCA
TGGACCAATGTGAGAGTTCAACCCGGAGGCATCAGGAGGCACAGGAGGCCTGCAGCTCCCAGGGCCTCAT
CCTGCACGGCTCGGGCATGCTCTTACCCTGTGGCTCGGATCGGTTCCGTGGTGTGGAGTATGTGTGCTGT
CCCCCTCCAGGGACCCCCGACCCATCTGGGACAGCAGTTGGTGACCCCTCCACCCGGTCCTGGCCCCCGG
GGAGCAGAGTAGAGGGGGCTGAGGACGAGGAAGAGGAGGAATCCTTCCCACAGCCAGTAGATGATTACTT
CGTGGAGCCTCCGCAGGCTGAAGAGGAAGAGGAAACGGTCCCACCCCCAAGCTCCCATACACTTGCAGTG
GTCGGCAAAGTCACTCCCACCCCGAGGCCCACAGACGGTGTGGATATTTACTTTGGCATGCCTGGGGAAA
TCAGTGAGCACGAGGGGTTCCTGAGGGCCAAGATGGACCTGGAGGAGCGTAGGATGCGCCAGATTAATGA
GGTGATGCGTGAATGGGCCATGGCAGACAACCAGTCCAAGAACCTGCCTAAAGCCGACAGACAGGCCCTG
AATGAGCACTTCCAGTCCATTCTGCAGACTCTGGAGGAGCAGGTGTCTGGTGAGCGACAGCGCCTGGTGG
AAACCCACGCCACCCGCGTCATCGCCCTTATCAACGACCAGCGCCGGGCTGCCTTGGAGGGCTTCCTGGC
AGCCCTGCAGGCAGATCCGCCTCAGGCGGAGCGTGTCCTGTTGGCCCTGCGGCGCTACCTGCGTGCGGAG
CAGAAGGAACAGAGGCACACGCTGCGCCACTACCAGCATGTGGCCGCCGTGGATCCCGAGAAGGCACAGC
AGATGCGCTTCCAGGTGCATACCCACCTTCAAGTGATTGAGGAGAGGGTGAATCAGAGCCTGGGCCTGCT
TGACCAGAACCCCCACCTGGCTCAGGAGCTGCGGCCCCAAATCCAGGAACTCCTCCACTCTGAACACCTG
GGTCCCAGTGAATTGGAAGCCCCTGCCCCTGGGGGCAGCAGCGAGGACAAGGGTGGGCTGCAGCCTCCAG
ATTCCAAGGATGACACCCCCATGACCCTTCCAAAAGGGTCCACAGAACAAGATGCTGCATCCCCTGAGAA
AGAGAAGATGAACCCGCTGGAACAGTATGAGCGAAAGGTGAATGCGTCTGTTCCAAGGGGTTTCCCTTTC
CACTCATCGGAGATTCAGAGGGATGAGCTGGCACCAGCTGGGACAGGGGTGTCCCGTGAGGCTGTGTCGG
GTCTGCTGATCATGGGAGCGGGCGGAGGCTCCCTCATCGTCCTCTCCATGCTGCTCCTGCGCAGGAAGAA
GCCCTACGGGGCTATCAGCCATGGCGTGGTGGAGGTGGACCCCATGCTGACCCTGGAGGAGCAGCAGCTC
CGCGAACTGCAGCGGCACGGCTATGAGAACCCCACTTACCGCTTCCTGGAGGAACGACCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215282 representing NM_005166
Red=Cloning site Green=Tags(s)

MGPASPAARGLSRRPGQPPLPLLLPLLLLLLRAQPAIGSLAGGSPGAAEAPGSAQVAGLCGRLTLHRDLR
TGRWEPDPQRSRRCLRDPQRVLEYCRQMYPELQIARVEQATQAIPMERWCGGSRSGSCAHPHHQVVPFRC
LPGEFVSEALLVPEGCRFLHQERMDQCESSTRRHQEAQEACSSQGLILHGSGMLLPCGSDRFRGVEYVCC
PPPGTPDPSGTAVGDPSTRSWPPGSRVEGAEDEEEEESFPQPVDDYFVEPPQAEEEEETVPPPSSHTLAV
VGKVTPTPRPTDGVDIYFGMPGEISEHEGFLRAKMDLEERRMRQINEVMREWAMADNQSKNLPKADRQAL
NEHFQSILQTLEEQVSGERQRLVETHATRVIALINDQRRAALEGFLAALQADPPQAERVLLALRRYLRAE
QKEQRHTLRHYQHVAAVDPEKAQQMRFQVHTHLQVIEERVNQSLGLLDQNPHLAQELRPQIQELLHSEHL
GPSELEAPAPGGSSEDKGGLQPPDSKDDTPMTLPKGSTEQDAASPEKEKMNPLEQYERKVNASVPRGFPF
HSSEIQRDELAPAGTGVSREAVSGLLIMGAGGGSLIVLSMLLLRRKKPYGAISHGVVEVDPMLTLEEQQL
RELQRHGYENPTYRFLEERP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005166
ORF Size 1950 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005166.1, NM_005166.2, NM_005166.3, NM_005166.4, NP_005157.1
RefSeq Size 2447 bp
RefSeq ORF 1953 bp
Locus ID 333
Cytogenetics 19q13.12
Domains A4_EXTRA
Protein Families Druggable Genome, Transmembrane
MW 72.18 kDa
Gene Summary This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein that is cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "APLP1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-APLP1 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools