Kv4.2 (KCND2) (NM_012281) Human Tagged ORF Clone

CAT#: RC215266

Reviews ()
Write a review

KCND2 (Myc-DDK-tagged)-Human potassium voltage-gated channel, Shal-related subfamily, member 2 (KCND2)



  "NM_012281" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCND2
Synonyms KV4.2; RK5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC215266 representing NM_012281
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGGGTGGCAGCGTGGCTGCCTTTTGCAAGGGCAGCGGCTATCGGGTGGATGCCTGTGGCCT
CGGGGCCTATGCCGGCTCCCCCGAGGCAGGAGAGGAAAAGGACCCAAGATGCTCTCATTGTGCTGAATGT
GAGTGGCACCCGCTTCCAGACGTGGCAGGACACCCTGGAACGTTACCCAGACACTCTACTGGGCAGTTCT
GAGAGGGACTTTTTCTACCACCCAGAAACTCAGCAGTATTTCTTTGACCGTGACCCAGACATCTTCCGCC
ACATCCTGAATTTCTACCGCACTGGGAAGCTCCACTATCCTCGCCACGAGTGCATCTCTGCTTACGATGA
AGAACTGGCCTTCTTTGGCCTCATCCCGGAAATCATCGGCGACTGCTGTTATGAGGAGTACAAGGATCGC
AGGCGAGAGAACGCCGAGCGCCTGCAGGACGACGCGGATACCGACACCGCTGGGGAGAGCGCCTTGCCCA
CCATGACTGCAAGGCAGAGGGTCTGGAGGGCCTTCGAGAACCCCCACACCAGCACGATGGCCCTGGTGTT
CTACTATGTCACGGGGTTTTTCATTGCCGTCTCTGTCATCGCGAATGTGGTGGAAACAGTGCCGTGCGGA
TCAAGCCCAGGTCACATTAAAGAACTGCCCTGTGGAGAGCGGTATGCTGTGGCCTTCTTCTGCTTGGACA
CGGCCTGCGTCATGATCTTCACAGTTGAGTATTTGCTTCGCCTGGCTGCAGCGCCTAGTCGTTACCGTTT
TGTGCGTAGTGTCATGAGTATCATCGACGTGGTGGCCATCCTGCCTTATTACATTGGGCTGGTGATGACA
GACAATGAGGACGTCAGCGGAGCCTTTGTCACACTCCGAGTCTTCCGGGTCTTCAGGATCTTTAAGTTTT
CCCGCCACTCTCAAGGCCTGCGCATCCTGGGGTACACACTGAAGAGTTGTGCCTCAGAATTGGGCTTCTT
GCTTTTCTCGCTCACCATGGCTATCATCATCTTCGCTACAGTTATGTTCTACGCAGAGAAGGGGTCTTCG
GCTAGCAAGTTCACCAGCATCCCTGCAGCCTTCTGGTATACCATCGTCACCATGACAACACTAGGGTATG
GTGACATGGTGCCAAAAACCATAGCAGGGAAGATTTTTGGTTCTATCTGTTCGCTGAGTGGGGTCTTGGT
CATTGCTCTACCTGTTCCGGTGATTGTATCCAACTTCAGTCGCATCTACCACCAGAATCAACGAGCAGAC
AAACGAAGGGCACAAAAGAAAGCTAGACTGGCCAGGATCCGGGCAGCCAAAAGCGGAAGCGCAAATGCTT
ACATGCAGAGCAAACGGAATGGTTTACTCAGTAATCAGCTGCAGTCCTCAGAGGATGAGCAGGCTTTTGT
TAGCAAATCCGGCTCCAGCTTTGAAACCCAGCACCACCACCTGCTTCACTGCCTGGAAAAAACCACGAAT
CACGAGTTTGTGGACGAACAAGTCTTTGAAGAAAGCTGCATGGAAGTTGCAACTGTTAATCGTCCTTCAA
GTCACAGTCCTTCACTGTCTTCACAACAAGGAGTCACCAGCACCTGCTGTTCACGACGACACAAAAAAAC
TTTTCGCATCCCAAATGCCAATGTATCAGGAAGCCATCAAGGTAGTATACAAGAACTCAGCACGATTCAG
ATCAGATGTGTGGAGAGAACACCTCTGTCTAACAGCCGATCCAGTTTAAATGCCAAAATGGAAGAGTGTG
TTAAACTAAACTGTGAACAACCTTATGTGACTACAGCAATAATAAGCATCCCAACACCTCCAGTAACCAC
ACCAGAAGGAGACGATAGGCCAGAATCCCCTGAGTACTCAGGAGGAAATATTGTCAGAGTTTCTGCTTTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215266 representing NM_012281
Red=Cloning site Green=Tags(s)

MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLERYPDTLLGSS
ERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELAFFGLIPEIIGDCCYEEYKDR
RRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHTSTMALVFYYVTGFFIAVSVIANVVETVPCG
SSPGHIKELPCGERYAVAFFCLDTACVMIFTVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMT
DNEDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSS
ASKFTSIPAAFWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTTN
HEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRIPNANVSGSHQGSIQELSTIQ
IRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012281
ORF Size 1890 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012281.3
RefSeq Size 5333 bp
RefSeq ORF 1893 bp
Locus ID 3751
UniProt ID Q9NZV8
Cytogenetics 7q31.31
Domains BTB, K_tetra, ion_trans
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 70.4 kDa
Gene Summary Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member mediates a rapidly inactivating, A-type outward potassium current which is not under the control of the N terminus as it is in Shaker channels. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "KCND2"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit Polyclonal Anti-KCND2 Antibody
    • 100 ul

USD 475.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.