CTXN3 (NM_001048252) Human Tagged ORF Clone

CAT#: RC215242

CTXN3 (Myc-DDK-tagged)-Human cortexin 3 (CTXN3), transcript variant 1

Clone Modification / Custom Cloning Service

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CTXN3 (NM_001048252) Human Tagged ORF Clone
Symbol CTXN3
Synonyms KABE; KABE
Vector pCMV6-Entry
Sequence Data
>RC215242 representing NM_001048252
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATGGAGGACAGCCCATCCCCTCATCCCTAGTGCCCCTTGGGAACGAATCAGCAGATTCTAGCATGT
CCCTGGAGCAGAAAATGACATTTGTTTTTGTGATTCTGTTGTTTATTTTCTTGGGCATTCTCATTGTCCG
GTGCTTCCGGATTCTTTTGGATCCATATCGAAGCATGCCAACCTCTACCTGGGCTGATGGACTTGAAGGC
CTGGAGAAAGGGCAGTTCGACCATGCCCTTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC215242 representing NM_001048252
Red=Cloning site Green=Tags(s)

MDGGQPIPSSLVPLGNESADSSMSLEQKMTFVFVILLFIFLGILIVRCFRILLDPYRSMPTSTWADGLEG
LEKGQFDHALA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001048252
ORF Size 243 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001048252.1, NM_001048252.2, NP_001041717
RefSeq Size 1660
RefSeq ORF 246
Locus ID 613212
Cytogenetics 5q23.2
Protein Families Transmembrane
MW 8.8 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)