GPR35 (NM_005301) Human Tagged ORF Clone

CAT#: RC215174

GPR35 (Myc-DDK-tagged)-Human G protein-coupled receptor 35 (GPR35), transcript variant 1

Change vector?

  • TrueORF®

USD 485


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GPR35 (NM_005301) Human Tagged ORF Clone
Symbol GPR35
Synonyms G protein-coupled receptor 35
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC215174 representing NM_005301
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGGCACCTACAACACCTGTGGCTCCAGCGACCTCACCTGGCCCCCAGCGATCAAGCTGGGCTTCT
ACGCCTACTTGGGCGTCCTGCTGGTGCTAGGCCTGCTGCTCAACAGCCTGGCGCTCTGGGTGTTCTGCTG
CCGCATGCAGCAGTGGACGGAGACCCGCATCTACATGACCAACCTGGCGGTGGCCGACCTCTGCCTGCTG
TGCACCTTGCCCTTCGTGCTGCACTCCCTGCGAGACACCTCAGACACGCCGCTGTGCCAGCTCTCCCAGG
GCATCTACCTGACCAACAGGTACATGAGCATCAGCCTGGTCACGGCCATCGCCGTGGACCGCTATGTGGC
CGTGCGGCACCCGCTGCGTGCCCGCGGGCTGCGGTCCCCCAGGCAGGCTGCGGCCGTGTGCGCGGTCCTC
TGGGTGCTGGTCATCGGCTCCCTGGTGGCTCGCTGGCTCCTGGGGATTCAGGAGGGCGGCTTCTGCTTCA
GGAGCACCCGGCACAATTTCAACTCCATGGCGTTCCCGCTGCTGGGATTCTACCTGCCCCTGGCCGTGGT
GGTCTTCTGCTCCCTGAAGGTGGTGACTGCCCTGGCCCAGAGGCCACCCACCGACGTGGGGCAGGCAGAG
GCCACCCGCAAGGCTGCCCGCATGGTCTGGGCCAACCTCCTGGTGTTCGTGGTCTGCTTCCTGCCCCTGC
ACGTGGGGCTGACAGTGCGCCTCGCAGTGGGCTGGAACGCCTGTGCCCTCCTGGAGACGATCCGTCGCGC
CCTGTACATAACCAGCAAGCTCTCAGATGCCAACTGCTGCCTGGACGCCATCTGCTACTACTACATGGCC
AAGGAGTTCCAGGAGGCGTCTGCACTGGCCGTGGCTCCCAGTGCTAAGGCCCACAAAAGCCAGGACTCTC
TGTGCGTGACCCTCGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC215174 representing NM_005301
Red=Cloning site Green=Tags(s)

MNGTYNTCGSSDLTWPPAIKLGFYAYLGVLLVLGLLLNSLALWVFCCRMQQWTETRIYMTNLAVADLCLL
CTLPFVLHSLRDTSDTPLCQLSQGIYLTNRYMSISLVTAIAVDRYVAVRHPLRARGLRSPRQAAAVCAVL
WVLVIGSLVARWLLGIQEGGFCFRSTRHNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAE
ATRKAARMVWANLLVFVVCFLPLHVGLTVRLAVGWNACALLETIRRALYITSKLSDANCCLDAICYYYMA
KEFQEASALAVAPSAKAHKSQDSLCVTLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005301
ORF Size 927 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005301.1, NM_005301.2, NM_005301.3, NP_005292
RefSeq Size 1875
RefSeq ORF 930
Locus ID 2859
Cytogenetics 2q37.3
Domains 7tm_1
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 33.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations