KIST (UHMK1) (NM_175866) Human Tagged ORF Clone

CAT#: RC214962

Reviews ()
Write a review

UHMK1 (Myc-DDK-tagged)-Human U2AF homology motif (UHM) kinase 1 (UHMK1), transcript variant 1



Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product images

Other products for "UHMK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol UHMK1
Synonyms KIS; KIST; P-CIP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214962 representing NM_175866
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGATCCGGCTGCGCCTGGGGCGCGGAGCCGCCGCGTTTTCTGGAGGCCTTCGGGCGGCTGTGGC
AGGTACAGAGCCGTCTGGGTAGCGGCTCCTCCGCCTCGGTGTATCGGGTTCGCTGCTGCGGCAACCCTGG
CTCGCCCCCCGGCGCCCTCAAGCAGTTCTTGCCGCCAGGAACCACCGGGGCTGCGGCCTCTGCCGCCGAG
TATGGTTTCCGCAAAGAGAGGGCGGCGCTGGAACAGTTGCAGGGTCACAGAAACATCGTGACTTTGTATG
GAGTGTTTACAATCCACTTTTCTCCAAATGTGCCATCACGCTGTCTGTTGCTTGAACTCCTGGATGTCAG
TGTTTCGGAATTGCTCTTATATTCCAGTCACCAGGGTTGTTCCATGTGGATGATACAGCATTGTGCCCGA
GATGTTTTGGAGGCCCTTGCTTTTCTTCATCATGAGGGCTATGTCCATGCGGACCTCAAACCACGTAACA
TATTGTGGAGTGCAGAGAATGAATGTTTTAAACTCATTGACTTTGGACTTAGCTTCAAAGAAGGCAATCA
GGATGTAAAGTATATTCAGACAGACGGGTATCGGGCTCCAGAAGCAGAATTGCAAAATTGCTTGGCCCAG
GCTGGCCTGCAGAGTGATACAGAATGTACCTCAGCTGTTGATCTGTGGAGCCTAGGAATCATTTTACTGG
AAATGTTCTCAGGAATGAAACTGAAACATACAGTCAGATCTCAGGAATGGAAGGCAAACAGTTCTGCTAT
TATTGATCACATATTTGCCAGTAAAGCAGTGGTGAATGCCGCAATTCCAGCCTATCACCTAAGAGACCTT
ATCAAAAGCATGCTTCATGATGATCCAAGCAGAAGAATTCCTGCTGAAATGGCATTGTGCAGCCCATTCT
TTAGCATTCCTTTTGCCCCTCATATTGAAGATCTGGTCATGCTTCCCACTCCAGTGCTAAGACTGCTGAA
TGTGCTGGATGATGATTATCTTGAGAATGAAGAGGAATATGAAGATGTTGTAGAAGATGTAAAAGAGGAG
TGTCAAAAATATGGACCAGTGGTATCTCTACTTGTTCCAAAGGAAAATCCTGGCAGAGGACAAGTCTTTG
TTGAGTATGCAAATGCTGGTGATTCCAAAGCTGCGCAGAAATTACTGACTGGAAGGATGTTTGATGGGAA
GTTTGTTGTGGCTACATTCTACCCGCTGAGTGCCTACAAGAGGGGATATCTGTATCAAACCTTGCTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214962 representing NM_175866
Red=Cloning site Green=Tags(s)

MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAE
YGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCAR
DVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQ
AGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDL
IKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEE
CQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_175866
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_175866.5
RefSeq Size 2901 bp
RefSeq ORF 1260 bp
Locus ID 127933
UniProt ID Q8TAS1
Cytogenetics 1q23.3
Protein Families Druggable Genome, Protein Kinase
MW 46.4 kDa
Gene Summary The gene encodes a serine/threonine protein kinase that promotes cell cycle progression through G1 by phosphorylation of the cyclin-dependent kinase inhibitor 1B (p27Kip1), which causes nuclear export and degradation. The encoded protein is also thought to function in the adult nervous system and the gene has been associated with schizophrenia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.