KDM5B (NM_006618) Human Tagged ORF Clone

CAT#: RC214918

Reviews ()
Write a review

KDM5B (Myc-DDK-tagged)-Human lysine (K)-specific demethylase 5B (KDM5B)



Reconstitution Protocol

USD 1,321.00

In Stock*

Size
    • 10 ug

Product images

Other products for "KDM5B"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KDM5B
Synonyms CT31; JARID1B; MRT65; PLU-1; PLU1; PPP1R98; PUT1; RBBP2H1A; RBP2-H1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214918 representing NM_006618
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCGGCCACCACACTGCACCCAGGCCCGCGCCCGGCGCTGCCCCTCGGGGGCCCGGGCCCGCTGG
GCGAGTTCCTGCCTCCACCCGAGTGCCCGGTCTTCGAACCCAGCTGGGAAGAGTTCGCGGACCCCTTCGC
TTTCATCCACAAGATCCGGCCCATAGCCGAGCAGACTGGCATCTGTAAGGTGCGGCCGCCGCCGGATTGG
CAGCCACCATTTGCATGTGATGTTGATAAACTTCATTTTACGCCACGTATCCAGAGACTGAATGAATTGG
AGGCCCAAACTCGTGTAAAATTGAATTTCTTGGACCAGATTGCAAAGTACTGGGAGTTACAGGGAAGTAC
TCTGAAAATTCCACATGTGGAGAGGAAGATCTTGGACTTATTTCAGCTTAATAAGTTAGTTGCAGAAGAA
GGTGGATTTGCAGTTGTTTGCAAGGATAGAAAATGGACCAAAATTGCTACCAAGATGGGGTTTGCTCCTG
GCAAAGCAGTGGGCTCACATATCAGAGGGCATTATGAACGAATTCTCAACCCCTACAACTTATTCCTGTC
CGGAGACAGCCTAAGGTGTTTGCAGAAGCCAAACCTGACCACAGACACTAAGGACAAGGAGTACAAACCC
CATGATATTCCCCAGAGGCAGTCTGTGCAGCCTTCGGAAACGTGCCCCCCAGCCCGACGAGCAAAACGCA
TGAGAGCAGAGGCCATGAATATTAAAATAGAACCCGAGGAGACAACAGAAGCCAGAACTCATAATCTGAG
ACGTCGAATGGGTTGTCCAACTCCAAAATGTGAAAATGAGAAAGAAATGAAGAGTAGCATCAAGCAAGAA
CCTATTGAGAGGAAAGATTATATTGTAGAAAATGAGAAGGAAAAGCCCAAGAGTCGATCTAAAAAAGCCA
CCAATGCTGTGGACCTGTATGTCTGTCTTTTATGTGGCAGTGGCAATGATGAAGACCGGCTACTGTTGTG
TGATGGCTGTGATGACAGTTACCATACCTTTTGCTTGATCCCACCTCTCCATGATGTTCCCAAGGGAGAC
TGGAGGTGTCCTAAGTGTTTGGCTCAGGAATGTAGTAAGCCACAAGAAGCATTTGGCTTTGAACAAGCAG
CCAGGGACTATACCCTCCGTACTTTTGGGGAAATGGCAGATGCGTTCAAATCTGATTACTTCAACATGCC
AGTCCATATGGTCCCCACAGAGCTTGTTGAGAAAGAATTTTGGAGACTAGTAAGCACTATTGAGGAGGAT
GTCACAGTGGAATATGGAGCTGACATTGCCTCAAAGGAATTTGGCAGTGGCTTTCCTGTCCGAGATGGGA
AAATCAAACTCTCACCTGAGGAAGAGGAGTATCTTGATAGTGGCTGGAATTTGAACAACATGCCAGTGAT
GGAGCAGTCTGTCCTTGCACATATTACTGCTGATATATGTGGCATGAAACTTCCTTGGTTGTATGTGGGA
ATGTGCTTTTCTTCATTCTGTTGGCACATTGAAGACCACTGGAGCTATTCAATTAACTACTTGCACTGGG
GTGAGCCAAAAACCTGGTATGGAGTCCCAGGGTATGCTGCTGAGCAGCTAGAAAATGTAATGAAGAAACT
AGCTCCAGAACTCTTTGTGTCCCAGCCGGATCTCCTCCATCAGCTTGTGACCATCATGAACCCCAATACC
CTGATGACTCATGAAGTGCCTGTTTACCGAACTAATCAGTGTGCTGGGGAGTTTGTGATTACATTTCCAA
GAGCCTACCACAGTGGTTTTAACCAGGGTTTTAATTTTGCTGAGGCTGTTAACTTCTGCACTGTTGATTG
GCTGCCATTAGGCCGACAGTGTGTGGAGCATTATCGCTTGCTTCATCGATATTGTGTGTTTTCCCATGAT
GAGATGATCTGCAAGATGGCTTCCAAGGCTGATGTATTAGATGTTGTAGTGGCTTCAACTGTTCAGAAAG
ACATGGCCATTATGATTGAGGATGAGAAAGCTTTAAGAGAAACTGTCCGTAAATTGGGAGTGATTGATTC
GGAAAGAATGGATTTTGAGCTGTTGCCAGATGATGAACGTCAGTGTGTAAAATGCAAAACTACATGCTTC
ATGTCTGCCATCTCCTGTTCTTGTAAACCTGGCCTTCTTGTTTGCCTGCATCATGTAAAAGAATTGTGTT
CCTGTCCTCCTTATAAATATAAATTGCGGTATAGGTACACGCTGGATGATCTCTACCCTATGATGAATGC
ATTGAAGCTTCGAGCAGAATCTTACAACGAATGGGCCTTGAATGTGAATGAAGCTTTGGAGGCAAAGATC
AACAAGAAGAAAAGCCTTGTCAGCTTCAAGGCTTTAATTGAAGAATCTGAAATGAAGAAATTCCCAGACA
ATGATCTTTTGCGACACCTTCGCCTAGTCACACAGGATGCAGAGAAGTGTGCCTCTGTTGCGCAGCAGTT
GCTTAATGGCAAAAGGCAAACTAGATATCGATCTGGTGGAGGGAAATCCCAAAATCAGTTGACAGTGAAT
GAGCTCCGGCAGTTTGTAACACAGCTGTATGCTCTTCCATGTGTCCTCAGTCAGACACCATTACTAAAGG
ATCTCTTGAATCGTGTAGAAGATTTTCAACAGCATAGTCAGAAACTACTCTCTGAGGAAACGCCTAGTGC
TGCGGAGCTGCAGGACTTGCTAGATGTCAGCTTTGAATTTGATGTTGAACTTCCACAGCTTGCTGAGATG
CGTATCCGTTTGGAACAAGCCCGTTGGCTAGAAGAGGTGCAGCAAGCTTGCCTAGACCCCAGCTCCCTTA
CTTTAGATGATATGAGACGTCTCATAGACCTAGGGGTAGGGCTGGCCCCGTATTCAGCAGTGGAGAAAGC
TATGGCCCGGCTGCAGGAACTGCTCACAGTGTCAGAGCACTGGGACGACAAAGCCAAGAGTCTCCTCAAG
GCCAGGCCACGACATTCATTGAATAGCCTTGCTACGGCAGTAAAGGAAATCGAAGAGATCCCTGCATATC
TGCCCAATGGTGCGGCTCTGAAAGACTCAGTGCAGAGAGCCAGAGACTGGCTTCAGGATGTAGAGGGCCT
GCAGGCTGGAGGACGTGTGCCAGTGTTAGACACACTCATAGAACTTGTTACACGAGGCCGATCTATCCCG
GTACATCTGAATTCTTTGCCAAGACTGGAAACCCTAGTAGCTGAGGTTCAGGCTTGGAAAGAATGTGCTG
TTAATACATTCTTGACTGAGAATTCTCCATATTCTCTCTTAGAGGTGCTGTGTCCTCGATGTGATATTGG
CCTTTTGGGATTGAAAAGGAAGCAGAGAAAGTTAAAGGAGCCCTTGCCAAATGGAAAGAAAAAAAGCACC
AAATTAGAGAGTCTGAGTGACCTGGAGAGAGCTTTAACTGAAAGCAAGGAGACTGCTTCAGCTATGGCAA
CTCTTGGGGAAGCTCGCCTAAGGGAAATGGAAGCCTTGCAGTCTCTCAGACTCGCCAATGAAGGGAAATT
GCTGTCGCCTCTCCAAGATGTGGATATAAAAATCTGCCTATGTCAGAAGGCCCCAGCTGCCCCTATGATT
CAATGTGAACTCTGCAGGGATGCTTTCCACACCAGTTGTGTGGCGGTACCCAGTATTTCACAGGGCCTGC
GAATCTGGCTTTGTCCCCATTGTCGGAGGTCAGAGAAACCTCCATTAGAGAAAATTCTGCCCCTGCTCGC
CTCCCTTCAGCGTATCCGAGTTCGCCTTCCTGAGGGAGATGCACTTCGATATATGATTGAAAGAACCGTG
AACTGGCAGCACAGAGCCCAGCAACTGCTTTCGTCAGGGAATCTTAAATTTGTGCAAGATCGAGTGGGCT
CAGGACTGTTATATAGCAGATGGCAAGCCTCAGCAGGACAGGTGTCAGACACAAACAAGGTATCTCAACC
TCCTGGCACAACATCATTTTCTTTGCCTGATGACTGGGACAACAGAACCTCATATTTGCACTCCCCCTTC
TCAACTGGACGAAGTTGTATCCCCCTCCATGGTGTTAGTCCAGAAGTGAATGAACTATTGATGGAAGCCC
AGCTGCTCCAGGTATCCCTTCCTGAAATTCAGGAACTTTACCAGACTTTACTTGCAAAGCCAAGCCCTGC
TCAGCAGACTGACCGAAGCTCACCAGTGAGACCCAGCAGTGAGAAGAATGACTGTTGCCGAGGGAAGCGA
GATGGAATTAACAGTCTTGAGAGAAAACTGAAGAGACGCCTGGAAAGAGAGGGCCTCTCCAGTGAGCGGT
GGGAACGAGTTAAGAAAATGCGGACCCCCAAAAAGAAGAAAATCAAACTGAGCCACCCCAAGGACATGAA
CAATTTCAAGTTAGAGAGAGAGCGTAGCTATGAATTAGTTCGTTCTGCTGAAACTCATTCCCTGCCCTCA
GACACATCCTATTCCGAACAGGAAGACTCTGAGGATGAAGATGCCATCTGCCCAGCTGTGAGCTGCCTGC
AGCCAGAAGGAGATGAGGTGGACTGGGTCCAGTGTGATGGCAGCTGCAATCAGTGGTTTCATCAGGTCTG
TGTTGGTGTCTCCCCAGAGATGGCAGAGAAAGAAGACTACATCTGTGTGCGCTGTACTGTGAAGGACGCA
CCAAGCCGAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214918 representing NM_006618
Red=Cloning site Green=Tags(s)

MEAATTLHPGPRPALPLGGPGPLGEFLPPPECPVFEPSWEEFADPFAFIHKIRPIAEQTGICKVRPPPDW
QPPFACDVDKLHFTPRIQRLNELEAQTRVKLNFLDQIAKYWELQGSTLKIPHVERKILDLFQLNKLVAEE
GGFAVVCKDRKWTKIATKMGFAPGKAVGSHIRGHYERILNPYNLFLSGDSLRCLQKPNLTTDTKDKEYKP
HDIPQRQSVQPSETCPPARRAKRMRAEAMNIKIEPEETTEARTHNLRRRMGCPTPKCENEKEMKSSIKQE
PIERKDYIVENEKEKPKSRSKKATNAVDLYVCLLCGSGNDEDRLLLCDGCDDSYHTFCLIPPLHDVPKGD
WRCPKCLAQECSKPQEAFGFEQAARDYTLRTFGEMADAFKSDYFNMPVHMVPTELVEKEFWRLVSTIEED
VTVEYGADIASKEFGSGFPVRDGKIKLSPEEEEYLDSGWNLNNMPVMEQSVLAHITADICGMKLPWLYVG
MCFSSFCWHIEDHWSYSINYLHWGEPKTWYGVPGYAAEQLENVMKKLAPELFVSQPDLLHQLVTIMNPNT
LMTHEVPVYRTNQCAGEFVITFPRAYHSGFNQGFNFAEAVNFCTVDWLPLGRQCVEHYRLLHRYCVFSHD
EMICKMASKADVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFELLPDDERQCVKCKTTCF
MSAISCSCKPGLLVCLHHVKELCSCPPYKYKLRYRYTLDDLYPMMNALKLRAESYNEWALNVNEALEAKI
NKKKSLVSFKALIEESEMKKFPDNDLLRHLRLVTQDAEKCASVAQQLLNGKRQTRYRSGGGKSQNQLTVN
ELRQFVTQLYALPCVLSQTPLLKDLLNRVEDFQQHSQKLLSEETPSAAELQDLLDVSFEFDVELPQLAEM
RIRLEQARWLEEVQQACLDPSSLTLDDMRRLIDLGVGLAPYSAVEKAMARLQELLTVSEHWDDKAKSLLK
ARPRHSLNSLATAVKEIEEIPAYLPNGAALKDSVQRARDWLQDVEGLQAGGRVPVLDTLIELVTRGRSIP
VHLNSLPRLETLVAEVQAWKECAVNTFLTENSPYSLLEVLCPRCDIGLLGLKRKQRKLKEPLPNGKKKST
KLESLSDLERALTESKETASAMATLGEARLREMEALQSLRLANEGKLLSPLQDVDIKICLCQKAPAAPMI
QCELCRDAFHTSCVAVPSISQGLRIWLCPHCRRSEKPPLEKILPLLASLQRIRVRLPEGDALRYMIERTV
NWQHRAQQLLSSGNLKFVQDRVGSGLLYSRWQASAGQVSDTNKVSQPPGTTSFSLPDDWDNRTSYLHSPF
STGRSCIPLHGVSPEVNELLMEAQLLQVSLPEIQELYQTLLAKPSPAQQTDRSSPVRPSSEKNDCCRGKR
DGINSLERKLKRRLEREGLSSERWERVKKMRTPKKKKIKLSHPKDMNNFKLERERSYELVRSAETHSLPS
DTSYSEQEDSEDEDAICPAVSCLQPEGDEVDWVQCDGSCNQWFHQVCVGVSPEMAEKEDYICVRCTVKDA
PSRK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006618
ORF Size 4632 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006618.5
RefSeq Size 6393 bp
RefSeq ORF 4635 bp
Locus ID 10765
UniProt ID Q9UGL1
Cytogenetics 1q32.1
Domains ARID, PHD, JmjC, JmjN, zf-C5HC2
Protein Families Druggable Genome, Transcription Factors
MW 175.5 kDa
Gene Summary This gene encodes a lysine-specific histone demethylase that belongs to the jumonji/ARID domain-containing family of histone demethylases. The encoded protein is capable of demethylating tri-, di- and monomethylated lysine 4 of histone H3. This protein plays a role in the transcriptional repression or certain tumor suppressor genes and is upregulated in certain cancer cells. This protein may also play a role in genome stability and DNA repair. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Nov 2016]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.