ADCY6(ADCY6) (NM_020983) Human Tagged ORF Clone

CAT#: RC214902

ADCY6 (Myc-DDK-tagged)-Human adenylate cyclase 6 (ADCY6), transcript variant 2

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,710.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ADCY6(ADCY6) (NM_020983) Human Tagged ORF Clone
Symbol ADCY6
Synonyms AC6
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214902 representing NM_020983
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCATGGTTTAGTGGCCTCCTGGTCCCTAAAGTGGATGAACGGAAAACAGCCTGGGGTGAACGCAATG
GGCAGAAGCGTTCGCGGCGCCGTGGCACTCGGGCAGGTGGCTTCTGCACGCCCCGCTATATGAGCTGCCT
CCGGGATGCAGAGCCACCCAGCCCCACCCCTGCGGGCCCCCCTCGGTGCCCCTGGCAGGATGACGCCTTC
ATCCGGAGGGGCGGCCCAGGCAAGGGCAAGGAGCTGGGGCTGCGGGCAGTGGCCCTGGGCTTCGAGGATA
CCGAGGTGACAACGACAGCGGGCGGGACGGCTGAGGTGGCGCCCGACGCGGTGCCCAGGAGTGGGCGATC
CTGCTGGCGCCGTCTGGTGCAGGTGTTCCAGTCGAAGCAGTTCCGTTCGGCCAAGCTGGAGCGCCTGTAC
CAGCGGTACTTCTTCCAGATGAACCAGAGCAGCCTGACGCTGCTGATGGCGGTGCTGGTGCTGCTCACAG
CGGTGCTGCTGGCTTTCCACGCCGCACCCGCCCGCCCTCAGCCTGCCTATGTGGCACTGTTGGCCTGTGC
CGCCGCCCTGTTCGTGGGGCTCATGGTGGTGTGTAACCGGCATAGCTTCCGCCAGGACTCCATGTGGGTG
GTGAGCTACGTGGTGCTGGGCATCCTGGCGGCAGTGCAGGTCGGGGGCGCTCTCGCAGCAGACCCGCGCA
GCCCCTCTGCGGGCCTCTGGTGCCCTGTGTTCTTTGTCTACATCGCCTACACGCTCCTCCCCATCCGCAT
GCGGGCTGCCGTCCTCAGCGGCCTGGGCCTCTCCACCTTGCATTTGATCTTGGCCTGGCAACTTAACCGT
GGTGATGCCTTCCTCTGGAAGCAGCTCGGTGCCAATGTGCTGCTGTTCCTCTGCACCAACGTCATTGGCA
TCTGCACACACTATCCAGCAGAGGTGTCTCAGCGCCAGGCCTTTCAGGAGACCCGCGGTTACATCCAGGC
CCGGCTCCACCTGCAGCATGAGAATCGGCAGCAGGAGCGGCTGCTGCTGTCGGTATTGCCCCAGCACGTT
GCCATGGAGATGAAAGAAGACATCAACACAAAAAAAGAAGACATGATGTTCCACAAGATCTACATACAGA
AGCATGACAATGTCAGCATCCTGTTTGCAGACATTGAGGGCTTCACCAGCCTGGCATCCCAGTGCACTGC
GCAGGAGCTGGTCATGACCCTGAATGAGCTCTTTGCCCGGTTTGACAAGCTGGCTGCGGAGAATCACTGC
CTGAGGATCAAGATCTTGGGGGACTGTTACTACTGTGTGTCAGGGCTGCCGGAGGCCCGGGCCGACCATG
CCCACTGCTGTGTGGAGATGGGGGTAGACATGATTGAGGCCATCTCGCTGGTACGTGAGGTGACAGGTGT
GAATGTGAACATGCGCGTGGGCATCCACAGCGGGCGCGTGCACTGCGGCGTCCTTGGCTTGCGGAAATGG
CAGTTCGATGTGTGGTCCAATGATGTGACCCTGGCCAACCACATGGAGGCAGGAGGCCGGGCTGGCCGCA
TCCACATCACTCGGGCAACACTGCAGTACCTGAACGGGGACTACGAGGTGGAGCCAGGCCGTGGTGGCGA
GCGCAACGCGTACCTCAAGGAGCAGCACATTGAGACTTTCCTCATCCTGGGCGCCAGCCAGAAACGGAAA
GAGGAGAAGGCCATGCTGGCCAAGCTGCAGCGGACTCGGGCCAACTCCATGGAAGGGCTGATGCCGCGCT
GGGTTCCTGATCGTGCCTTCTCCCGGACCAAGGACTCCAAGGCCTTCCGCCAGATGGGCATTGATGATTC
CAGCAAAGACAACCGGGGCACCCAAGATGCCCTGAACCCTGAGGATGAGGTGGATGAGTTCCTGAGCCGT
GCCATCGATGCCCGCAGCATTGATCAGCTGCGGAAGGACCATGTGCGCCGGTTTCTGCTCACCTTCCAGA
GAGAGGATCTTGAGAAGAAGTACTCCCGGAAGGTGGATCCCCGCTTCGGAGCCTACGTTGCCTGTGCCCT
GTTGGTCTTCTGCTTCATCTGCTTCATCCAGCTTCTCATCTTCCCACACTCCACCCTGATGCTTGGGATC
TATGCCAGCATCTTCCTGCTGCTGCTAATCACCGTGCTGATCTGTGCTGTGTACTCCTGTGGTTCTCTGT
TCCCTAAGGCCCTGCAACGTCTGTCCCGCAGCATTGTCCGCTCACGGGCACATAGCACCGCAGTTGGCAT
CTTTTCCGTCCTGCTTGTGTTTACTTCTGCCATTGCCAACATGTACTTCATCGGGAACATGCTGCTGAGT
CTCTTGGCCAGCTCTGTCTTCCTGCACATCAGCAGCATCGGGAAGTTGGCCATGATCTTTGTCTTGGGGC
TCATCTATTTGGTGCTGCTTCTGCTGGGTCCCCCAGCCACCATCTTTGACAACTATGACCTACTGCTTGG
CGTCCATGGCTTGGCTTCTTCCAATGAGACCTTTGATGGGCTGGACTGTCCAGCTGCAGGGAGGGTGGCC
CTCAAATATATGACCCCTGTGATTCTGCTGGTGTTTGCGCTGGCGCTGTATCTGCATGCTCAGCAGGTGG
AGTCGACTGCCCGCCTAGACTTCCTCTGGAAACTACAGGCAACAGGGGAGAAGGAGGAGATGGAGGAGCT
ACAGGCATACAACCGGAGGCTGCTGCATAACATTCTGCCCAAGGACGTGGCGGCCCACTTCCTGGCCCGG
GAGCGCCGCAATGATGAACTCTACTATCAGTCGTGTGAGTGTGTGGCTGTTATGTTTGCCTCCATTGCCA
ACTTCTCTGAGTTCTATGTGGAGCTGGAGGCAAACAATGAGGGTGTCGAGTGCCTGCGGCTGCTCAACGA
GATCATCGCTGACTTTGATGAGATTATCAGCGAGGAGCGGTTCCGGCAGCTGGAAAAGATCAAGACGATT
GGTAGCACCTACATGGCTGCCTCAGGGCTGAACGCCAGCACCTACGATCAGGTGGGCCGCTCCCACATCA
CTGCCCTGGCTGACTACGCCATGCGGCTCATGGAGCAGATGAAGCACATCAATGAGCACTCCTTCAACAA
TTTCCAGATGAAGATTGGGCTGAACATGGGCCCAGTCGTGGCAGGTGTCATCGGGGCTCGGAAGCCACAG
TATGACATCTGGGGGAACACAGTGAATGTCTCTAGTCGTATGGACAGCACGGGGGTCCCCGACCGAATCC
AGGTGACCACGGACCTGTACCAGGTTCTAGCTGCCAAGGGCTACCAGCTGGAGTGTCGAGGGGTGGTCAA
GGTGAAGGGCAAGGGGGAGATGACCACCTACTTCCTCAATGGGGGCCCCAGCAGT


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214902 representing NM_020983
Red=Cloning site Green=Tags(s)

MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTPAGPPRCPWQDDAF
IRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWRRLVQVFQSKQFRSAKLERLY
QRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAYVALLACAAALFVGLMVVCNRHSFRQDSMWV
VSYVVLGILAAVQVGGALAADPRSPSAGLWCPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNR
GDAFLWKQLGANVLLFLCTNVIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHV
AMEMKEDINTKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKW
QFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNAYLKEQHIETFLILGASQKRK
EEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGTQDALNPEDEVDEFLSR
AIDARSIDQLRKDHVRRFLLTFQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGI
YASIFLLLLITVLICAVYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMYFIGNMLLS
LLASSVFLHISSIGKLAMIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVA
LKYMTPVILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHFLAR
ERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIISEERFRQLEKIKTI
GSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNNFQMKIGLNMGPVVAGVIGARKPQ
YDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKGYQLECRGVVKVKGKGEMTTYFLNGGPSS

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_020983
ORF Size 3345 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_020983.1, NM_020983.2, NP_066193
RefSeq Size 5877
RefSeq ORF 3348
Locus ID 112
Cytogenetics 12q13.12
Protein Families Transmembrane, Druggable Genome
Protein Pathways Purine metabolism, Chemokine signaling pathway, Oocyte meiosis, Vascular smooth muscle contraction, Gap junction, Taste transduction, GnRH signaling pathway, Progesterone-mediated oocyte maturation, Melanogenesis, Dilated cardiomyopathy
MW 124.7 kDa
Gene Summary This gene encodes a member of the adenylyl cyclase family of proteins, which are required for the synthesis of cyclic AMP. All members of this family have an intracellular N-terminus, a tandem repeat of six transmembrane domains separated by a cytoplasmic loop, and a C-terminal cytoplasmic domain. The two cytoplasmic regions bind ATP and form the catalytic core of the protein. Adenylyl cyclases are important effectors of transmembrane signaling pathways and are regulated by the activity of G protein coupled receptor signaling. This protein belongs to a small subclass of adenylyl cyclase proteins that are functionally related and are inhibited by protein kinase A, calcium ions and nitric oxide. A mutation in this gene is associated with arthrogryposis multiplex congenita. [provided by RefSeq, May 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)