ADCY10 (NM_018417) Human Tagged ORF Clone

CAT#: RC214876

ADCY10 (Myc-DDK-tagged)-Human adenylate cyclase 10 (soluble) (ADCY10), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,109.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ADCY10 (NM_018417) Human Tagged ORF Clone
Symbol ADCY10
Synonyms HCA2; hsAC; SAC; SACI; Sacy
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214876 representing NM_018417
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACACTCCAAAAGAAGAATTCCAGGACTGGCCCATAGTCAGAATAGCAGCTCATTTACCAGACCTCA
TTGTCTATGGACATTTCTCCCCAGAGCGACCCTTTATGGATTATTTTGACGGAGTCCTGATGTTTGTTGA
TATTTCAGGTTTTACTGCAATGACTGAGAAGTTCAGCAGTGCCATGTACATGGACAGAGGGGCTGAGCAG
TTGGTGGAGATCCTCAACTACCACATAAGTGCAATAGTGGAGAAAGTGTTGATTTTTGGAGGAGACATCC
TGAAATTTGCAGGTGATGCACTGCTAGCCCTGTGGAGGGTGGAGCGAAAGCAGCTGAAAAACATTATCAC
AGTGGTAATTAAATGTAGCCTGGAGATCCATGGATTGTTTGAGACCCAGGAGTGGGAAGAAGGCCTAGAC
ATCCGAGTCAAGATAGGACTGGCTGCTGGCCACATCAGCATGTTGGTCTTTGGAGATGAAACACACAGCC
ACTTTCTGGTGATTGGTCAGGCAGTGGACGATGTGCGCCTTGCCCAGAACATGGCTCAGATGAATGATGT
TATTCTGTCACCAAACTGCTGGCAGCTCTGTGACCGGAGCATGATTGAAATTGAGAGTGTTCCAGATCAG
AGAGCAGTTAAGGTTAACTTCTTAAAACCACCCCCCAATTTTAATTTTGATGAATTTTTCACAAAGTGTA
CGACCTTCATGCATTATTATCCTTCTGGTGAGCACAAAAACCTCCTGAGGCTTGCATGCACGCTGAAGCC
TGATCCTGAACTGGAGATGTCCCTACAAAAGTATGTGATGGAAAGCATTTTGAAGCAGATTGATAACAAA
CAGCTTCAGGGCTATTTATCTGAGCTTCGCCCAGTGACGATTGTGTTTGTGAACCTGATGTTTGAAGACC
AAGACAAAGCAGAAGAGATAGGCCCAGCCATCCAGGATGCCTATATGCACATCACTTCTGTCCTGAAGAT
CTTCCAAGGCCAAATCAATAAAGTCTTCATGTTTGACAAGGGCTGCTCTTTCCTCTGTGTCTTTGGCTTC
CCTGGGGAAAAGGTACCTGACGAGCTCACTCATGCTCTGGAATGTGCTATGGATATATTTGACTTCTGCT
CTCAAGTCCACAAAATCCAAACTGTATCCATCGGTGTTGCCAGTGGGATTGTCTTCTGTGGGATCGTTGG
ACACACTGTGAGACACGAGTACACAGTCATTGGTCAAAAAGTCAACTTAGCTGCCAGGATGATGATGTAC
TACCCAGGAATTGTGACCTGCGACTCTGTCACCTACAATGGGAGCAACCTACCAGCGTACTTTTTTAAAG
AGCTTCCAAAGAAAGTTATGAAAGGTGTTGCAGATTCTGGACCATTGTATCAGTATTGGGGCCGTACTGA
GAAAGTCATGTTTGGTATGGCGTGCCTCATCTGCAACAGAAAGGAGGATTACCCTTTGCTGGGACGTAAT
AAAGAGATCAACTACTTCATGTATACTATGAAGAAATTTTTGATATCTAACAGCAGCCAAGTCTTAATGT
ATGAGGGATTACCAGGATATGGAAAAAGCCAGATACTTATGAAAATTGAGTACCTGGCCCAAGGTAAGAA
TCACAGGATTATTGCCATTTCATTGAATAAGATCAGCTTCCATCAAACTTTCTATACCATCCAGATGTTC
ATGGCCAATGTCCTAGGCCTAGACACTTGTAAACATTATAAAGAACGACAGACCAACCTTCGAAATAAAG
TCATGACACTGTTGGATGAAAAGTTCTACTGTCTTCTTAATGACATTTTCCATGTTCAGTTCCCTATTTC
TCGGGAGATTTCCAGGATGAGCACCTTGAAAAAGCAAAAACAATTGGAAATATTGTTTATGAAGATCTTG
AAGCTGATAGTGAAAGAGGAAAGGATTATTTTTATCATTGATGAGGCCCAGTTTGTGGATTCGACCTCCT
GGAGATTTATGGAGAAGCTTATCCGGACTCTTCCTATCTTCATCATTATGTCCCTGTGTCCCTTCGTTAA
CATTCCCTGTGCAGCTGCCAGGGCCGTAATAAAGAACAGGAACACCACCTACATTGTCATTGGTGCAGTA
CAGCCTAACGACATCTCCAACAAGATCTGTCTTGACCTCAATGTGAGCTGCATCTCCAAAGAACTGGACT
CGTACCTGGGGGAGGGAAGCTGTGGGATTCCATTTTACTGTGAAGAATTGCTTAAAAACCTGGAACATCA
TGAGGTACTCGTTTTCCAACAAACGGAGTCTGAGGAAAAGACAAATAGGACCTGGAATAACCTGTTCAAG
TATTCCATTAAGCTAACAGAGAAGTTAAACATGGTTACTCTCCATAGTGATAAGGAAAGTGAAGAAGTCT
GTCACCTCACAAGTGGTGTCAGACTGAAAAACCTGTCACCTCCAACGTCATTAAAAGAAATCTCTCTGAT
CCAGCTGGATAGCATGAGACTTTCCCACCAAATGCTGGTGAGATGTGCTGCCATCATTGGCCTGACCTTC
ACCACTGAGTTGTTGTTTGAGATTCTCCCCTGTTGGAATATGAAGATGATGATCAAGACCCTGGCAACCC
TAGTGGAATCTAACATTTTTTATTGTTTCCGGAATGGCAAGGAGCTTCAAAAGGCCCTGAAACAGAATGA
TCCCTCATTTGAGGTGCACTATCGTTCCTTGTCTCTGAAGCCCAGTGAAGGGATGGATCACGGTGAAGAG
GAACAGCTTCGTGAACTGGAGAATGAGGTGATCGAGTGCCACAGGATTCGATTCTGTAACCCTATGATGC
AGAAAACAGCCTACGAGCTGTGGCTCAAGGACCAGAGAAAAGCCATGCACTTGAAATGTGCCCGCTTTTT
AGAAGAAGATGCCCACAGATGTGACCACTGCCGAGGCAGGGACTTCATTCCCTATCATCACTTCACAGTG
AATATTCGGCTCAACGCTTTAGACATGGATGCCATTAAAAAGATGGCTATGTCTCATGGATTTAAAACTG
AAGAAAAGCTTATCTTGTCCAACTCAGAGATTCCTGAGACATCTGCATTTTTTCCTGAAAATCGCAGTCC
TGAAGAAATAAGAGAAAAGATCTTGAATTTCTTTGACCACGTTTTAACAAAAATGAAGACATCTGACGAA
GACATTATCCCTCTGGAATCTTGCCAGTGTGAAGAAATCCTAGAGATTGTCATCTTGCCTCTGGCCCACC
ATTTTCTGGCTTTGGGAGAAAATGACAAAGCCTTATATTACTTCTTAGAAATTGCATCTGCTTATCTCAT
CTTTTGTGATAACTACATGGCATACATGTATTTGAATGAAGGACAGAAGTTGCTAAAAACTCTCAAGAAG
GACAAATCTTGGAGCCAGACATTTGAGTCTGCCACCTTTTACAGCCTCAAAGGTGAGGTCTGTTTCAATA
TGGGCCAGATAGTGCTTGCCAAGAAAATGCTGAGGAAGGCACTGAAGCTCCTCAACCGAATCTTTCCTTA
CAACTTAATCTCCTTGTTTCTCCATATCCATGTCGAGAAAAACAGACACTTTCATTATGTGAATCGGCAG
GCCCAAGAGAGCCCACCTCCAGGGAAGAAGAGGCTGGCACAACTTTACCGGCAAACTGTCTGCCTTTCCT
TGCTGTGGCGCATCTATAGCTACAGTTATCTTTTTCACTGCAAGTATTATGCCCACCTGGCAGTTATGAT
GCAAATGAATACTGCACTGGAAACTCAAAATTGTTTCCAGATCATTAAGGCTTACCTAGACTATTCGCTA
TACCACCACCTGGCTGGCTACAAAGGTGTGTGGTTCAAATATGAAGTCATGGCCATGGAGCACATCTTCA
ACCTCCCCCTGAAAGGCGAGGGCATTGAAATCGTGGCATACGTGGCTGAGACACTGGTCTTCAACAAGCT
CATAATGGGACACCTGGATTTGGCCATTGAGTTAGGCTCCCGAGCCCTTCAGATGTGGGCACTGCTCCAG
AATCCCAACCGACATTATCAGTCCCTCTGCAGACTTAGCAGATGTCTCCTTCTGAACAGCAGATACCCGC
AATTGATCCAGGTGCTGGGGCGGCTGTGGGAGCTTTCTGTAACACAGGAACACATCTTCAGCAAGGCATT
TTTCTATTTTGTCTGCTTGGACATCCTGCTTTATTCTGGTTTTGTTTATAGAACATTTGAAGAATGTTTG
GAATTCATACACCAATACGAAAACAACAGAATCCTCAAGTTCCACAGTGGACTCCTCCTGGGACTTTATT
CCTCTGTAGCTATCTGGTATGCCAGACTTCAGGAATGGGACAACTTTTACAAATTTTCCAATAGAGCTAA
AAATCTTTTGCCAAGAAGAACCATGACACTTACTTACTATGACGGAATATCTAGGTACATGGAGGGGCAA
GTTCTTCACCTTCAAAAACAAATCAAAGAACAGTCAGAGAATGCCCAAGCCAGTGGGGAGGAGCTACTCA
AGAACTTGGAGAATCTGGTGGCTCAAAATACCACTGGCCCTGTCTTTTGCCCAAGGCTCTACCACCTGAT
GGCTTACGTCTGTATATTAATGGGAGATGGGCAGAAATGTGGCCTCTTCCTGAACACAGCCTTGCGGCTC
TCTGAAACACAGGGGAATATACTGGAGAAATGCTGGCTGAACATGAACAAAGAATCATGGTACTCAACCT
CTGAGTTAAAAGAAGACCAATGGCTTCAGACGATCTTGAGTCTCCCATCATGGGAAAAAATTGTAGCAGG
CAGGGTAAACATTCAGGATCTTCAAAAAAACAAATTCCTGATGAGAGCTAATACCGTGGACAATCATTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214876 representing NM_018417
Red=Cloning site Green=Tags(s)

MNTPKEEFQDWPIVRIAAHLPDLIVYGHFSPERPFMDYFDGVLMFVDISGFTAMTEKFSSAMYMDRGAEQ
LVEILNYHISAIVEKVLIFGGDILKFAGDALLALWRVERKQLKNIITVVIKCSLEIHGLFETQEWEEGLD
IRVKIGLAAGHISMLVFGDETHSHFLVIGQAVDDVRLAQNMAQMNDVILSPNCWQLCDRSMIEIESVPDQ
RAVKVNFLKPPPNFNFDEFFTKCTTFMHYYPSGEHKNLLRLACTLKPDPELEMSLQKYVMESILKQIDNK
QLQGYLSELRPVTIVFVNLMFEDQDKAEEIGPAIQDAYMHITSVLKIFQGQINKVFMFDKGCSFLCVFGF
PGEKVPDELTHALECAMDIFDFCSQVHKIQTVSIGVASGIVFCGIVGHTVRHEYTVIGQKVNLAARMMMY
YPGIVTCDSVTYNGSNLPAYFFKELPKKVMKGVADSGPLYQYWGRTEKVMFGMACLICNRKEDYPLLGRN
KEINYFMYTMKKFLISNSSQVLMYEGLPGYGKSQILMKIEYLAQGKNHRIIAISLNKISFHQTFYTIQMF
MANVLGLDTCKHYKERQTNLRNKVMTLLDEKFYCLLNDIFHVQFPISREISRMSTLKKQKQLEILFMKIL
KLIVKEERIIFIIDEAQFVDSTSWRFMEKLIRTLPIFIIMSLCPFVNIPCAAARAVIKNRNTTYIVIGAV
QPNDISNKICLDLNVSCISKELDSYLGEGSCGIPFYCEELLKNLEHHEVLVFQQTESEEKTNRTWNNLFK
YSIKLTEKLNMVTLHSDKESEEVCHLTSGVRLKNLSPPTSLKEISLIQLDSMRLSHQMLVRCAAIIGLTF
TTELLFEILPCWNMKMMIKTLATLVESNIFYCFRNGKELQKALKQNDPSFEVHYRSLSLKPSEGMDHGEE
EQLRELENEVIECHRIRFCNPMMQKTAYELWLKDQRKAMHLKCARFLEEDAHRCDHCRGRDFIPYHHFTV
NIRLNALDMDAIKKMAMSHGFKTEEKLILSNSEIPETSAFFPENRSPEEIREKILNFFDHVLTKMKTSDE
DIIPLESCQCEEILEIVILPLAHHFLALGENDKALYYFLEIASAYLIFCDNYMAYMYLNEGQKLLKTLKK
DKSWSQTFESATFYSLKGEVCFNMGQIVLAKKMLRKALKLLNRIFPYNLISLFLHIHVEKNRHFHYVNRQ
AQESPPPGKKRLAQLYRQTVCLSLLWRIYSYSYLFHCKYYAHLAVMMQMNTALETQNCFQIIKAYLDYSL
YHHLAGYKGVWFKYEVMAMEHIFNLPLKGEGIEIVAYVAETLVFNKLIMGHLDLAIELGSRALQMWALLQ
NPNRHYQSLCRLSRCLLLNSRYPQLIQVLGRLWELSVTQEHIFSKAFFYFVCLDILLYSGFVYRTFEECL
EFIHQYENNRILKFHSGLLLGLYSSVAIWYARLQEWDNFYKFSNRAKNLLPRRTMTLTYYDGISRYMEGQ
VLHLQKQIKEQSENAQASGEELLKNLENLVAQNTTGPVFCPRLYHLMAYVCILMGDGQKCGLFLNTALRL
SETQGNILEKCWLNMNKESWYSTSELKEDQWLQTILSLPSWEKIVAGRVNIQDLQKNKFLMRANTVDNHF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018417
ORF Size 4830 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018417.1, NM_018417.2, NM_018417.3, NM_018417.4, NM_018417.5, NP_060887
RefSeq Size 5061
RefSeq ORF 4833
Locus ID 55811
Cytogenetics 1q24.2
Protein Families Transmembrane, Druggable Genome
Protein Pathways Purine metabolism
MW 187 kDa
Gene Summary The protein encoded by this gene belongs to a distinct class of adenylyl cyclases that is soluble and insensitive to G protein or forskolin regulation. Activity of this protein is regulated by bicarbonate. Variation at this gene has been observed in patients with absorptive hypercalciuria. Alternatively spliced transcript variants encoding different isoforms have been observed. There is a pseudogene of this gene on chromosome 6. [provided by RefSeq, Jul 2014]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations