CRMP3 (DPYSL4) (NM_006426) Human Tagged ORF Clone

CAT#: RC214821

Reviews ()
Write a review

DPYSL4 (Myc-DDK-tagged)-Human dihydropyrimidinase-like 4 (DPYSL4)



  "NM_006426" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 532.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "DPYSL4"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol DPYSL4
Synonyms CRMP3; DRP-4; ULIP4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214821 representing NM_006426.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTCCTTCCAGGGCAAGAAAAGCATCCCCCGGATCACGAGTGACCGCCTTCTGATCAGAGGTGGGAGG
ATCGTGAATGACGACCAGTCCTTTTACGCTGATGTGCACGTGGAAGATGGCTTGATAAAACAAATCGGA
GAAAACCTCATCGTCCCTGGGGGCATCAAGACCATTGACGCCCACGGCCTGATGGTCCTTCCTGGTGGC
GTTGACGTCCACACAAGGCTGCAGATGCCTGTCCTGGGCATGACACCGGCTGACGACTTCTGTCAGGGC
ACCAAGGCAGCGCTAGCAGGAGGAACCACCATGATCTTGGACCACGTCTTCCCCGACACGGGTGTGAGC
CTGCTGGCGGCCTACGAGCAGTGGCGGGAGCGGGCGGACAGCGCGGCCTGCTGCGACTACTCCCTGCAC
GTGGACATCACCCGATGGCATGAGAGCATCAAGGAGGAGCTGGAGGCCCTGGTCAAGGAGAAGGGTGTG
AACTCCTTCCTGGTCTTCATGGCATACAAGGACCGGTGCCAGTGCAGCGACAGCCAGATGTACGAGATC
TTCAGCATCATCCGGGACCTGGGGGCCTTGGCCCAGGTGCACGCTGAGAACGGGGACATCGTGGAGGAG
GAGCAGAAGCGGTTGCTGGAGCTCGGCATCACTGGCCCCGAGGGCCACGTGCTCAGCCACCCCGAGGAG
GTGGAGGCTGAGGCGGTGTACCGAGCTGTCACCATCGCCAAGCAGGCAAACTGCCCGCTGTACGTCACC
AAGGTGATGAGCAAGGGGGCGGCCGACGCCATCGCTCAGGCCAAGCGCAGAGGGGTGGTCGTGTTTGGG
GAGCCCATCACCGCCAGCCTGGGCACCGACGGTTCACACTACTGGAGCAAGAACTGGGCCAAGGCCGCA
GCCTTCGTCACATCACCCCCTGTCAACCCAGACCCCACCACGGCAGACCACCTCACCTGCTTGCTGTCC
AGCGGGGACCTCCAGGTGACAGGCAGCGCCCACTGCACCTTCACCACTGCCCAGAAGGCTGTGGGCAAG
GACAACTTCGCGCTGATCCCCGAGGGCACCAACGGCATTGAGGAGCGCATGTCGATGGTCTGGGAGAAA
TGTGTGGCCTCTGGGAAGATGGACGAGAATGAGTTCGTCGCGGTGACCAGTACAAATGCTGCCAAAATC
TTCAATTTTTACCCAAGGAAGGGGCGAGTGGCTGTGGGCTCTGACGCTGACCTGGTCATATGGAACCCC
AAGGCCACCAAGATCATCTCTGCCAAGACCCACAATCTGAACGTGGAGTACAACATCTTCGAGGGAGTG
GAGTGCCGGGGAGCGCCTGCCGTGGTCATAAGTCAGGGCCGAGTGGCGCTGGAGGACGGGAAGATGTTT
GTCACCCCGGGGGCGGGCCGCTTCGTCCCTCGGAAAACATTCCCGGACTTTGTCTACAAGAGGATCAAA
GCTCGCAACAGGCTGGCGGAGATCCACGGTGTGCCCCGTGGGCTGTATGACGGGCCCGTCCACGAGGTG
ATGGTGCCTGCCAAGCCAGGGAGTGGCGCTCCGGCCCGCGCGTCCTGCCCAGGCAAGATCTCCGTCCCT
CCTGTGCGCAACCTACATCAGTCGGGGTTCAGCCTATCTGGGTCTCAGGCTGATGACCACATCGCCCGA
CGCACAGCACAGAAGATCATGGCACCACCTGGCGGCCGCTCCAACATCACCTCTCTCTCC

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGAT
ATCCTGGATTACAAGGATGACGACGATAAG
GTTTAA
>Peptide sequence encoded by RC214821
Blue=ORF Red=Cloning site Green=Tag(s)

MSFQGKKSIPRITSDRLLIRGGRIVNDDQSFYADVHVEDGLIKQIGENLIVPGGIKTIDAHGLMVLPGG
VDVHTRLQMPVLGMTPADDFCQGTKAALAGGTTMILDHVFPDTGVSLLAAYEQWRERADSAACCDYSLH
VDITRWHESIKEELEALVKEKGVNSFLVFMAYKDRCQCSDSQMYEIFSIIRDLGALAQVHAENGDIVEE
EQKRLLELGITGPEGHVLSHPEEVEAEAVYRAVTIAKQANCPLYVTKVMSKGAADAIAQAKRRGVVVFG
EPITASLGTDGSHYWSKNWAKAAAFVTSPPVNPDPTTADHLTCLLSSGDLQVTGSAHCTFTTAQKAVGK
DNFALIPEGTNGIEERMSMVWEKCVASGKMDENEFVAVTSTNAAKIFNFYPRKGRVAVGSDADLVIWNP
KATKIISAKTHNLNVEYNIFEGVECRGAPAVVISQGRVALEDGKMFVTPGAGRFVPRKTFPDFVYKRIK
ARNRLAEIHGVPRGLYDGPVHEVMVPAKPGSGAPARASCPGKISVPPVRNLHQSGFSLSGSQADDHIAR
RTAQKIMAPPGGRSNITSLS

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV

Recombinant protein using RC214821 also available, TP314821
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006426
ORF Size 1716 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006426.3
RefSeq Size 2699 bp
RefSeq ORF 1719 bp
Locus ID 10570
UniProt ID O14531
Cytogenetics 10q26.3
Domains Amidohydro_1
MW 61.9 kDa
Gene Summary Necessary for signaling by class 3 semaphorins and subsequent remodeling of the cytoskeleton. Plays a role in axon guidance, neuronal growth cone collapse and cell migration (By similarity).[UniProtKB/Swiss-Prot Function]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Anti-DPYSL4 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.