SRP68 (NM_014230) Human Tagged ORF Clone

CAT#: RC214724

Reviews ()
Write a review

SRP68 (Myc-DDK-tagged)-Human signal recognition particle 68kDa (SRP68)


  "NM_014230" in other vectors (6)

USD 98.00

USD 770.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name SRP68 (NM_014230) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SRP68
Synonyms signal recognition particle 68kDa
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC214724 representing NM_014230
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGCTGAGAAGCAGGTCCCAGGCGGCGGCGGCGGCGGCGGCAGTGGCGGCGGCGGTGGCAGTGGCG
GCGGCGGTAGCGGCGGTGGACGTGGTGCCGGAGGGGAAGAAAATAAAGAAAACGAACGCCCTTCGGCCGG
ATCGAAGGCAAACAAAGAATTTGGGGATAGCCTGAGTTTGGAGATTCTTCAGATTATTAAGGAATCCCAG
CAGCAGCATGGTTTACGGCATGGAGATTTTCAGAGGTACAGGGGCTACTGTTCCCGTAGACAAAGACGTC
TTCGAAAAACACTCAACTTCAAGATGGGTAACAGACACAAATTCACAGGGAAGAAAGTGACTGAAGAGCT
TCTGACCGATAATAGATACTTGCTTCTGGTTCTGATGGATGCTGAAAGAGCCTGGAGCTACGCCATGCAG
CTGAAACAGGAAGCCAACACTGAACCCCGAAAACGGTTTCACTTGTTATCTCGCCTACGCAAAGCCGTGA
AGCATGCAGAGGAATTGGAACGCTTGTGTGAGAGCAATCGCGTGGATGCCAAGACCAAATTAGAGGCTCA
GGCTTACACAGCTTACCTCTCAGGAATGCTACGTTTTGAACATCAAGAATGGAAAGCTGCCATTGAGGCT
TTTAACAAATGCAAAACTATCTATGAGAAGCTAGCCAGTGCTTTCACAGAGGAGCAGGCTGTGCTGTATA
ACCAACGTGTGGAAGAGATTTCACCCAACATCCGCTATTGTGCATATAATATTGGGGACCAGTCAGCCAT
CAATGAACTCATGCAGATGAGATTGAGGTCTGGGGGCACTGAAGGTCTCTTGGCTGAAAAATTGGAGGCT
TTGATCACTCAGACTCGAGCCAAACAGGCAGCTACCATGAGTGAAGTGGAGTGGAGAGGGAGAACGGTTC
CAGTGAAGATTGACAAAGTGCGCATTTTCTTATTAGGACTGGCTGATAACGAAGCAGCTATTGTCCAGGC
TGAAAGCGAAGAAACTAAGGAGCGCCTGTTTGAATCAATGCTCAGCGAGTGTCGGGACGCCATCCAGGTG
GTTCGGGAGGAGCTCAAGCCAGATCAGAAACAGAGAGATTATATCCTTGAAGGAGAGCCAGGGAAGGTGT
CTAATCTTCAATACTTGCATAGCTACCTGACTTACATCAAGCTATCAACGGCAATCAAGCGTAATGAGAA
CATGGCCAAAGGTCTGCAGAGGGCTCTGCTGCAGCAGCAGCCAGAGGATGACAGCAAGTGCTCACCCCGG
CCCCAGGACCTGATCCGACTCTATGACATCATCTTACAGAATCTGGTGGAATTGCTCCAGCTTCCTGGTT
TAGAGGAAGACAAAGCCTTCCAGAAAGAGATAGGCCTCAAGACTCTGGTGTTCAAAGCTTACAGGTGTTT
TTTCATTGCTCAGTCCTATGTGCTGGTGAAGAAGTGGAGCGAAGCCCTTGTCCTGTATGACAGAGTCCTG
AAATATGCAAATGAAGTAAATTCTGATGCTGGCGCCTTCAAGAACAGCCTAAAGGACCTGCCTGATGTGC
AAGAGCTCATCACTCAAGTGCGGTCAGAGAAGTGCTCCCTGCAGGCCGCAGCCATCCTTGATGCAAACGA
CGCTCATCAAACAGAGACCTCCTCCTCCCAAGTCAAGGACAATAAGCCTCTGGTTGAACGGTTTGAGACA
TTCTGCCTGGACCCTTCCCTTGTCACCAAGCAAGCCAACCTTGTGCACTTCCCACCAGGCTTCCAGCCCA
TTCCCTGCAAGCCTTTGTTCTTTGACCTGGCCCTCAACCATGTGGCTTTCCCACCCCTTGAGGACAAGTT
GGAACAGAAGACCAAGAGTGGCCTCACTGGATACATCAAGGGCATCTTTGGATTCAGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214724 representing NM_014230
Red=Cloning site Green=Tags(s)

MAAEKQVPGGGGGGGSGGGGGSGGGGSGGGRGAGGEENKENERPSAGSKANKEFGDSLSLEILQIIKESQ
QQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTDNRYLLLVLMDAERAWSYAMQ
LKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEA
FNKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQSAINELMQMRLRSGGTEGLLAEKLEA
LITQTRAKQAATMSEVEWRGRTVPVKIDKVRIFLLGLADNEAAIVQAESEETKERLFESMLSECRDAIQV
VREELKPDQKQRDYILEGEPGKVSNLQYLHSYLTYIKLSTAIKRNENMAKGLQRALLQQQPEDDSKCSPR
PQDLIRLYDIILQNLVELLQLPGLEEDKAFQKEIGLKTLVFKAYRCFFIAQSYVLVKKWSEALVLYDRVL
KYANEVNSDAGAFKNSLKDLPDVQELITQVRSEKCSLQAAAILDANDAHQTETSSSQVKDNKPLVERFET
FCLDPSLVTKQANLVHFPPGFQPIPCKPLFFDLALNHVAFPPLEDKLEQKTKSGLTGYIKGIFGFRS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014230
ORF Size 1881 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014230.2, NM_014230.3, NP_055045.2
RefSeq Size 2515
RefSeq ORF 1884
Locus ID 6730
Cytogenetics 17q25.1
Protein Pathways Protein export
MW 70.5 kDa
Gene Summary This gene encodes a subunit of the signal recognition particle (SRP). The SRP is a ribonucleoprotein complex that transports secreted and membrane proteins to the endoplasmic reticulum for processing. The complex includes a 7S RNA and six protein subunits. The encoded protein is the 68kDa component of the SRP, and forms a heterodimer with the 72kDa subunit that is required for SRP function. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and three pseudogenes of this gene are located within the Smith-Magenis syndrome region on chromosome 17. [provided by RefSeq, May 2012]

Other Versions

Other products for "SRP68"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-SRP68 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools