DAB1 (NM_021080) Human Tagged ORF Clone

CAT#: RC214664

DAB1 (Myc-DDK-tagged)-Human disabled homolog 1 (Drosophila) (DAB1)

Clone Modification / Custom Cloning Service

USD 701.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DAB1 (NM_021080) Human Tagged ORF Clone
Symbol DAB1
Synonyms OTTHUMP00000010045; OTTHUMP00000011753; disabled homolog 1; disabled homolog 1 (Drosophila)
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214664 representing NM_021080
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAACTGAGACAGAACTTCAAGTAGCTGTGAAAACCAGCGCCAAGAAAGACTCCAGAAAGAAAGGTC
AGGATCGCAGTGAAGCCACTTTGATAAAGAGGTTTAAAGGTGAAGGGGTCCGGTACAAAGCCAAATTGAT
CGGGATTGATGAAGTTTCCGCAGCTCGGGGAGACAAGTTATGTCAAGATTCCATGATGAAACTCAAGGGC
GTTGTTGCTGGCGCTCGTTCCAAAGGAGAACACAAACAGAAAATCTTTTTAACCATCTCCTTTGGAGGAA
TCAAAATCTTTGATGAGAAGACAGGGGCCCTTCAGCATCATCATGCTGTTCATGAAATATCCTACATTGC
AAAGGACATTACAGATCACCGGGCCTTTGGATATGTTTGTGGGAAGGAAGGGAATCACAGATTTGTGGCC
ATAAAAACAGCCCAGGCGGCTGAACCTGTTATTCTGGACTTGAGAGATCTCTTTCAACTCATTTATGAAT
TGAAGCAAAGAGAAGAATTAGAAAAAAAGGCACAAAAGGATAAGCAGTGTGAACAAGCTGTGTACCAGAC
AATATTGGAAGAGGATGTTGAAGATCCTGTGTACCAGTACATTGTGTTTGAGGCTGGACACGAGCCAATC
CGTGATCCCGAAACGGAAGAAAACATTTATCAGGTTCCCACCAGCCAAAAGAAGGAAGGTGTTTATGATG
TGCCAAAAAGTCAACCTGTAAGTGCTGTGACCCAATTAGAACTTTTTGGGGACATGTCCACACCCCCTGA
TATAACCTCTCCCCCCACTCCTGCAACTCCAGGTGATGCCTTTATCCCATCTTCATCTCAGACCCTTCCA
GCGAGTGCAGATGTGTTTAGTTCTGTACCTTTCGGCACTGCTGCTGTACCCTCAGGTTACGTTGCAATGG
GCGCTGTCCTCCCGTCCTTCTGGGGTCAGCAGCCCCTCGTCCAACAGCAGATGGTCATGGGTGCCCAGCC
ACCAGTCGCTCAGGTGATGCCGGGGGCTCAGCCCATCGCATGGGGCCAGCCGGGTCTCTTTCCTGCCACT
CAGCAGCCCTGGCCAACTGTGGCCGGGCAGTTTCCGCCAGCCGCCTTCATGCCCACACAAACTGTTATGC
CTTTGCCAGCTGCCATGTTCCAAGGTCCCCTCACCCCCCTTGCCACCGTCCCAGGCACGAGTGACTCCAC
CAGGTCAAGTCCACAGACCGACAAGCCCAGGCAGAAAATGGGCAAAGAAACGTTTAAGGATTTCCAGATG
GCCCAGCCTCCGCCCGTGCCCTCCCGCAAACCCGACCAGCCCTCCCTCACCTGTACCTCAGAGGCCTTCT
CCAGTTACTTCAACAAAGTCGGGGTGGCACAGGATACAGACGACTGTGATGACTTTGACATCTCCCAGTT
GAATTTGACCCCTGTGACTTCTACCACACCATCGACCAACTCACCTCCAACCCCAGCCCCTAGACAGAGC
TCTCCATCCAAATCATCTGCATCCCATGCCAGTGATCCTACCACAGATGACATCTTTGAAGAGGGCTTTG
AAAGTCCCAGCAAAAGCGAAGAGCAAGAAGCTCCTGATGGATCACAGGCCTCATCCAACAGTGATCCATT
TGGTGAGCCCAGTGGGGAGCCCAGTGGTGATAATATAAGTCCACAGGCCGGTAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214664 representing NM_021080
Red=Cloning site Green=Tags(s)

MSTETELQVAVKTSAKKDSRKKGQDRSEATLIKRFKGEGVRYKAKLIGIDEVSAARGDKLCQDSMMKLKG
VVAGARSKGEHKQKIFLTISFGGIKIFDEKTGALQHHHAVHEISYIAKDITDHRAFGYVCGKEGNHRFVA
IKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPI
RDPETEENIYQVPTSQKKEGVYDVPKSQPVSAVTQLELFGDMSTPPDITSPPTPATPGDAFIPSSSQTLP
ASADVFSSVPFGTAAVPSGYVAMGAVLPSFWGQQPLVQQQMVMGAQPPVAQVMPGAQPIAWGQPGLFPAT
QQPWPTVAGQFPPAAFMPTQTVMPLPAAMFQGPLTPLATVPGTSDSTRSSPQTDKPRQKMGKETFKDFQM
AQPPPVPSRKPDQPSLTCTSEAFSSYFNKVGVAQDTDDCDDFDISQLNLTPVTSTTPSTNSPPTPAPRQS
SPSKSSASHASDPTTDDIFEEGFESPSKSEEQEAPDGSQASSNSDPFGEPSGEPSGDNISPQAGS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_021080
ORF Size 1665 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_021080.1, NM_021080.2, NM_021080.3, NP_066566
RefSeq Size 2580
RefSeq ORF 1668
Locus ID 1600
Cytogenetics 1p32.2
Domains PID
MW 59.8 kDa
Gene Summary The laminar organization of multiple neuronal types in the cerebral cortex is required for normal cognitive function. In mice, the disabled-1 gene plays a central role in brain development, directing the migration of cortical neurons past previously formed neurons to reach their proper layer. This gene is similar to disabled-1, and the protein encoded by this gene is thought to be a signal transducer that interacts with protein kinase pathways to regulate neuronal positioning in the developing brain. Alternatively spliced transcript variants of this gene have been reported, but their full length nature has not been determined. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations