ARSB (NM_000046) Human Tagged ORF Clone

CAT#: RC214604

ARSB (Myc-DDK-tagged)-Human arylsulfatase B (ARSB), transcript variant 1

Clone Modification / Custom Cloning Service

USD 680.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ARSB (NM_000046) Human Tagged ORF Clone
Symbol ARSB
Synonyms ASB; G4S; MPS6
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214604 representing NM_000046
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCCGCGCGGCGCGGCGAGCTTGCCCCGAGGCCCCGGACCTCGGCGGCTGCTCCTCCCCGTCGTCC
TCCCGCTGCTGCTGCTGCTGTTGTTGGCGCCGCCGGGCTCGGGCGCCGGGGCCAGCCGGCCGCCCCACCT
GGTCTTCTTGCTGGCAGACGACCTAGGCTGGAACGACGTCGGCTTCCACGGCTCCCGCATCCGCACGCCG
CACCTGGACGCGCTGGCGGCCGGCGGGGTGCTCCTGGACAACTACTACACGCAGCCGCTGTGCACGCCGT
CGCGGAGCCAGCTGCTCACTGGCCGCTACCAGATCCGTACAGGTTTACAGCACCAAATAATCTGGCCCTG
TCAGCCCAGCTGTGTTCCTCTGGATGAAAAACTCCTGCCCCAGCTCCTAAAAGAAGCAGGTTATACTACC
CATATGGTCGGAAAATGGCACCTGGGAATGTACCGGAAAGAATGCCTTCCAACCCGCCGAGGATTTGATA
CCTACTTTGGATATCTCCTGGGTAGTGAAGATTATTATTCCCATGAACGCTGTACATTAATTGACGCTCT
GAATGTCACACGATGTGCTCTTGATTTTCGAGATGGCGAAGAAGTTGCAACAGGATATAAAAATATGTAT
TCAACAAACATATTCACCAAAAGGGCTATAGCCCTCATAACTAACCATCCACCAGAGAAGCCTCTGTTTC
TCTACCTTGCTCTCCAGTCTGTGCATGAGCCCCTTCAGGTCCCTGAGGAATACTTGAAGCCATATGACTT
TATCCAAGACAAGAACAGGCATCACTATGCAGGAATGGTGTCCCTTATGGATGAAGCAGTAGGAAATGTC
ACTGCAGCTTTAAAAAGCAGTGGGCTCTGGAACAACACGGTGTTCATCTTTTCTACAGATAACGGAGGGC
AGACTTTGGCAGGGGGTAATAACTGGCCCCTTCGAGGAAGAAAATGGAGCCTGTGGGAAGGAGGCGTCCG
AGGGGTGGGCTTTGTGGCAAGCCCCTTGCTGAAGCAGAAGGGCGTGAAGAACCGGGAGCTCATCCACATC
TCTGACTGGCTGCCAACACTCGTGAAGCTGGCCAGGGGACACACCAATGGCACAAAGCCTCTGGATGGCT
TCGACGTGTGGAAAACCATCAGTGAAGGAAGCCCATCCCCCAGAATTGAGCTGCTGCATAATATTGACCC
GAACTTCGTGGACTCTTCACCGTGTCCCAGGAACAGCATGGCTCCAGCAAAGGATGACTCTTCTCTTCCA
GAATATTCAGCCTTTAACACATCTGTCCATGCTGCAATTAGACATGGAAATTGGAAACTCCTCACGGGCT
ACCCAGGCTGTGGTTACTGGTTCCCTCCACCGTCTCAATACAATGTTTCTGAGATACCCTCATCAGACCC
ACCAACCAAGACCCTCTGGCTCTTTGATATTGATCGGGACCCTGAAGAAAGACATGACCTGTCCAGAGAA
TATCCTCACATCGTCACAAAGCTCCTGTCCCGCCTACAGTTCTACCATAAACACTCAGTCCCCGTGTACT
TCCCTGCACAGGACCCCCGCTGTGATCCCAAGGCCACTGGGGTGTGGGGCCCTTGGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214604 representing NM_000046
Red=Cloning site Green=Tags(s)

MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTP
HLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTT
HMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMY
STNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNV
TAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHI
SDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSRE
YPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000046
ORF Size 1599 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000046.1, NM_000046.2, NM_000046.3, NP_000037
RefSeq Size 6089
RefSeq ORF 1602
Locus ID 411
Cytogenetics 5q14.1
Domains Sulfatase
Protein Families Druggable Genome
Protein Pathways Glycosaminoglycan degradation, Metabolic pathways, Lysosome
MW 59.69 kDa
Gene Summary Arylsulfatase B encoded by this gene belongs to the sulfatase family. The arylsulfatase B homodimer hydrolyzes sulfate groups of N-Acetyl-D-galactosamine, chondriotin sulfate, and dermatan sulfate. The protein is targeted to the lysozyme. Mucopolysaccharidosis type VI is an autosomal recessive lysosomal storage disorder resulting from a deficiency of arylsulfatase B. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Dec 2016]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)