FZD3 (NM_017412) Human Tagged ORF Clone

CAT#: RC214553

FZD3 (Myc-DDK-tagged)-Human frizzled family receptor 3 (FZD3), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,020.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FZD3 (NM_017412) Human Tagged ORF Clone
Symbol FZD3
Synonyms Fz-3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214553 representing NM_017412
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTATGACTTGGATTGTCTTCTCTCTTTGGCCCTTGACTGTGTTCATGGGGCATATAGGTGGGCACA
GTTTGTTTTCTTGTGAACCTATTACCTTGAGGATGTGCCAAGATTTGCCTTATAATACTACCTTCATGCC
TAATCTTCTGAATCATTATGACCAACAGACAGCAGCTTTGGCAATGGAGCCATTCCACCCTATGGTGAAT
CTGGATTGTTCTCGGGATTTCCGGCCTTTTCTTTGTGCACTCTACGCTCCTATTTGTATGGAATATGGAC
GTGTCACACTTCCCTGTCGTAGGCTGTGTCAGCGGGCTTACAGTGAGTGTTCGAAGCTCATGGAGATGTT
TGGTGTTCCTTGGCCTGAAGATATGGAATGCAGTAGGTTCCCAGATTGTGATGAGCCATATCCTCGACTT
GTGGATCTGAATTTAGCTGGAGAACCAACTGAAGGAGCCCCAGTGGCAGTGCAGAGAGACTATGGTTTTT
GGTGTCCCCGAGAGTTAAAAATTGATCCTGATCTGGGTTATTCTTTTCTGCATGTGCGTGATTGTTCACC
TCCTTGTCCAAATATGTACTTCAGAAGAGAAGAACTGTCATTTGCTCGCTATTTCATAGGATTGATTTCA
ATCATTTGCCTCTCGGCCACATTGTTTACTTTTTTAACTTTTTTGATTGATGTCACAAGATTCCGTTATC
CTGAAAGGCCTATTATATTTTATGCAGTCTGCTACATGATGGTATCCTTAATTTTCTTCATTGGATTTTT
GCTTGAAGATCGAGTAGCCTGCAATGCATCCATCCCTGCACAATATAAGGCTTCCACAGTGACACAAGGA
TCTCATAATAAAGCCTGTACCATGCTTTTTATGATACTCTATTTTTTTACTATGGCTGGCAGTGTATGGT
GGGTAATTCTTACCATCACATGGTTTTTAGCAGCTGTGCCAAAGTGGGGTAGTGAAGCTATTGAGAAGAA
AGCATTGCTGTTTCACGCCAGTGCATGGGGCATCCCCGGAACTCTAACCATCATCCTTTTAGCGATGAAT
AAAATTGAAGGTGACAATATTAGTGGCGTGTGTTTTGTTGGCCTCTACGATGTTGATGCATTGAGATATT
TTGTTCTTGCTCCCCTCTGCCTGTATGTGGTAGTTGGGGTTTCTCTCCTCTTAGCTGGCATTATATCCCT
AAACAGAGTTCGAATTGAGATTCCATTAGAAAAGGAGAACCAAGATAAATTAGTGAAGTTTATGATCCGG
ATCGGTGTTTTCAGCATTCTTTATCTCGTACCACTCTTGGTTGTAATTGGATGCTACTTTTATGAGCAAG
CTTACCGGGGCATCTGGGAAACAACGTGGATACAAGAACGCTGCAGAGAATATCACATTCCATGTCCATA
TCAGGTTACTCAAATGAGTCGTCCAGACTTGATTCTCTTTCTGATGAAATACCTGATGGCTCTCATAGTT
GGCATTCCCTCTGTATTTTGGGTTGGAAGCAAAAAGACATGCTTTGAATGGGCCAGTTTTTTTCATGGTC
GTAGGAAAAAAGAGATAGTGAATGAGAGCCGACAGGTACTCCAGGAACCTGATTTTGCTCAGTCTCTCCT
GAGGGATCCAAATACTCCTATCATAAGAAAGTCAAGGGGAACTTCCACTCAAGGAACATCCACCCATGCT
TCTTCAACTCAGCTGGCTATGGTGGATGATCAAAGAAGCAAAGCAGGAAGCATCCACAGCAAAGTGAGCA
GCTACCACGGCAGCCTCCACAGATCACGTGATGGCAGGTACACGCCCTGCAGTTACAGAGGAATGGAGGA
GAGACTACCTCATGGCAGCATGTCACGACTAACAGATCACTCCAGGCATAGTAGTTCTCATCGGCTCAAT
GAACAGTCACGACATAGCAGCATCAGAGATCTCAGTAATAATCCCATGACTCATATCACACATGGCACCA
GCATGAATCGGGTTATTGAAGAAGATGGAACCAGTGCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214553 representing NM_017412
Red=Cloning site Green=Tags(s)

MAMTWIVFSLWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVN
LDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRL
VDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYFIGLIS
IICLSATLFTFLTFLIDVTRFRYPERPIIFYAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQG
SHNKACTMLFMILYFFTMAGSVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMN
KIEGDNISGVCFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILFLMKYLMALIV
GIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDPNTPIIRKSRGTSTQGTSTHA
SSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPCSYRGMEERLPHGSMSRLTDHSRHSSSHRLN
EQSRHSSIRDLSNNPMTHITHGTSMNRVIEEDGTSA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017412
ORF Size 1998 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017412.1, NM_017412.2, NM_017412.3, NP_059108
RefSeq Size 3933
RefSeq ORF 2001
Locus ID 7976
Cytogenetics 8p21.1
Domains FRI, Frizzled
Protein Families GPCR, Transmembrane, Druggable Genome
Protein Pathways Wnt signaling pathway, Melanogenesis, Pathways in cancer, Colorectal cancer, Basal cell carcinoma
MW 76.1 kDa
Gene Summary This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. The function of this protein is unknown, although it may play a role in mammalian hair follicle development. Alternative splicing results in multiple transcript variants. This gene is a susceptibility locus for schizophrenia. [provided by RefSeq, Dec 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations