CCL14 (NM_032962) Human Tagged ORF Clone
CAT#: RC214541
- TrueORF®
CCL14 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 2
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_032962" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | CCL14 |
Synonyms | CC-1; CC-3; CKB1; HCC-1; HCC-1(1-74); HCC-1/HCC-3; HCC-3; MCIF; NCC-2; NCC2; SCYA14; SCYL2; SY14 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC214541 representing NM_032962
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAAGATCTCCGTGGCTGCCATTCCCTTCTTCCTCCTCATCACCATCGCCCTAGGGACCAAGACTGAAT CCTCCTCACAAACTGGGGGGAAACCGAAGGTTGTTAAAATACAGCTAAAGTTGGTGGGGGGACCTTACCA CCCCTCAGAGTGCTGCTTCACCTACACTACCTACAAGATCCCGCGTCAGCGGATTATGGATTACTATGAG ACCAACAGCCAGTGCTCCAAGCCCGGAATTGTCTTCATCACCAAAAGGGGCCATTCCGTCTGTACCAACC CCAGTGACAAGTGGGTCCAGGACTATATCAAGGACATGAAGGAGAAC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC214541 representing NM_032962
Red=Cloning site Green=Tags(s) MKISVAAIPFFLLITIALGTKTESSSQTGGKPKVVKIQLKLVGGPYHPSECCFTYTTYKIPRQRIMDYYE TNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_032962 |
ORF Size | 327 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_032962.4, NP_116738.1 |
RefSeq Size | 579 bp |
RefSeq ORF | 330 bp |
Locus ID | 6358 |
UniProt ID | Q16627 |
Cytogenetics | 17q12 |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
MW | 12.3 kDa |
Gene Summary | This gene, chemokine (C-C motif) ligand 14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. Multiple transcript variants encoding different isoforms have been found for this gene. Read-through transcripts are also expressed that include exons from the upstream cytokine gene, chemokine (C-C motif) ligand 15, and are represented as GeneID: 348249. [provided by RefSeq, Dec 2009] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC214541L3 | Lenti-ORF clone of CCL14 (Myc-DDK-tagged)-Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 2 |
USD 465.00 |
|
RC214541L4 | Lenti-ORF clone of CCL14 (mGFP-tagged)-Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 2 |
USD 465.00 |
|
RG214541 | CCL14 (tGFP-tagged) - Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 2 |
USD 365.00 |
|
SC309560 | CCL14 (untagged)-Human chemokine (C-C motif) ligand 14 (CCL14), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review