GRHL2 (NM_024915) Human Tagged ORF Clone

CAT#: RC214498

GRHL2 (Myc-DDK-tagged)-Human grainyhead-like 2 (Drosophila) (GRHL2)

Change vector?

USD 577


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GRHL2 (NM_024915) Human Tagged ORF Clone
Symbol GRHL2
Synonyms BOM; DFNA28; ECTDS; TFCP2L3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214498 representing NM_024915
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACAAGAGTCGGACAATAATAAAAGACTAGTGGCCTTAGTGCCCATGCCCAGTGACCCTCCATTCA
ATACCCGAAGAGCCTACACCAGTGAGGATGAAGCCTGGAAGTCATACTTGGAGAATCCCCTGACAGCAGC
CACCAAGGCCATGATGAGCATTAATGGTGATGAGGACAGTGCTGCTGCCCTCGGCCTGCTCTATGACTAC
TACAAGGTTCCTCGAGACAAGAGGCTGCTGTCTGTAAGCAAAGCAAGTGACAGCCAAGAAGACCAGGAGA
AAAGAAACTGCCTTGGCACCAGTGAAGCCCAGAGTAATTTGAGTGGAGGAGAAAACCGAGTGCAAGTCCT
AAAGACTGTTCCAGTGAACCTTTCCCTAAATCAAGATCACCTGGAGAATTCCAAGCGGGAACAGTACAGC
ATCAGCTTCCCCGAGAGCTCTGCCATCATCCCGGTGTCGGGAATCACGGTGGTGAAAGCTGAAGATTTCA
CACCAGTTTTCATGGCCCCACCTGTGCACTATCCCCGGGGAGATGGGGAAGAGCAACGAGTGGTTATCTT
TGAACAGACTCAGTATGACGTGCCCTCGCTGGCCACCCACAGCGCCTATCTCAAAGACGACCAGCGCAGC
ACTCCGGACAGCACATACAGCGAGAGCTTCAAGGACGCAGCCACAGAGAAATTTCGGAGTGCTTCAGTTG
GGGCTGAGGAGTACATGTATGATCAGACATCAAGTGGCACATTTCAGTACACCCTGGAAGCCACCAAATC
TCTCCGTCAGAAGCAGGGGGAGGGCCCCATGACCTACCTCAACAAAGGACAGTTCTATGCCATAACACTC
AGCGAGACCGGAGACAACAAATGCTTCCGACACCCCATCAGCAAAGTCAGGAGTGTGGTGATGGTGGTCT
TCAGTGAAGACAAAAACAGAGATGAACAGCTCAAATACTGGAAATACTGGCACTCTCGGCAGCATACGGC
GAAGCAGAGGGTCCTTGACATTGCCGATTACAAGGAGAGCTTTAATACGATTGGAAACATTGAAGAGATT
GCATATAATGCTGTTTCCTTTACCTGGGACGTGAATGAAGAGGCGAAGATTTTCATCACCGTGAATTGCT
TGAGCACAGATTTCTCCTCCCAAAAAGGGGTGAAAGGACTTCCTTTGATGATTCAGATTGACACATACAG
TTATAACAATCGTAGCAATAAACCCATTCATAGAGCTTATTGCCAGATCAAGGTCTTCTGTGACAAAGGA
GCAGAAAGAAAAATCCGAGATGAAGAGCGGAAGCAGAACAGGAAGAAAGGGAAAGGCCAGGCCTCCCAAA
CTCAATGCAACAGCTCCTCTGATGGGAAGTTGGCTGCCATACCTTTACAGAAGAAGAGTGACATCACCTA
CTTCAAAACCATGCCTGATCTCCACTCACAGCCAGTTCTCTTCATACCTGATGTTCACTTTGCAAACCTG
CAGAGGACCGGACAGGTGTATTACAACACGGATGATGAACGAGAAGGTGGCAGTGTCCTTGTTAAACGGA
TGTTCCGGCCCATGGAAGAGGAGTTTGGTCCAGTGCCTTCAAAGCAGATGAAAGAAGAAGGGACAAAGCG
AGTGCTCTTGTACGTGAGGAAGGAGACTGACGATGTGTTCGATGCATTGATGTTGAAGTCTCCCACAGTG
AAGGGCCTGATGGAAGCGATATCTGAGAAATATGGGCTGCCCGTGGAGAAGATAGCAAAGCTTTACAAGA
AAAGCAAAAAAGGCATCTTGGTGAACATGGATGACAACATCATCGAGCACTACTCGAACGAGGACACCTT
CATCCTCAACATGGAGAGCATGGTGGAGGGCTTCAAGGTCACGCTCATGGAAATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214498 representing NM_024915
Red=Cloning site Green=Tags(s)

MSQESDNNKRLVALVPMPSDPPFNTRRAYTSEDEAWKSYLENPLTAATKAMMSINGDEDSAAALGLLYDY
YKVPRDKRLLSVSKASDSQEDQEKRNCLGTSEAQSNLSGGENRVQVLKTVPVNLSLNQDHLENSKREQYS
ISFPESSAIIPVSGITVVKAEDFTPVFMAPPVHYPRGDGEEQRVVIFEQTQYDVPSLATHSAYLKDDQRS
TPDSTYSESFKDAATEKFRSASVGAEEYMYDQTSSGTFQYTLEATKSLRQKQGEGPMTYLNKGQFYAITL
SETGDNKCFRHPISKVRSVVMVVFSEDKNRDEQLKYWKYWHSRQHTAKQRVLDIADYKESFNTIGNIEEI
AYNAVSFTWDVNEEAKIFITVNCLSTDFSSQKGVKGLPLMIQIDTYSYNNRSNKPIHRAYCQIKVFCDKG
AERKIRDEERKQNRKKGKGQASQTQCNSSSDGKLAAIPLQKKSDITYFKTMPDLHSQPVLFIPDVHFANL
QRTGQVYYNTDDEREGGSVLVKRMFRPMEEEFGPVPSKQMKEEGTKRVLLYVRKETDDVFDALMLKSPTV
KGLMEAISEKYGLPVEKIAKLYKKSKKGILVNMDDNIIEHYSNEDTFILNMESMVEGFKVTLMEI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_024915
ORF Size 1875 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_024915.1, NM_024915.2, NM_024915.3, NP_079191
RefSeq Size 4793
RefSeq ORF 1878
Locus ID 79977
Cytogenetics 8q22.3
Protein Families Transcription Factors
MW 70.9 kDa
Gene Summary The protein encoded by this gene is a transcription factor that can act as a homodimer or as a heterodimer with either GRHL1 or GRHL3. Defects in this gene are a cause of non-syndromic sensorineural deafness autosomal dominant type 28 (DFNA28).[provided by RefSeq, Mar 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations