CACNG1 (NM_000727) Human Tagged ORF Clone

CAT#: RC214441

CACNG1 (Myc-DDK-tagged)-Human calcium channel, voltage-dependent, gamma subunit 1 (CACNG1)

Product Images

Circular map for RC214441

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: CACNG1
• Synonyms: CACNLG
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214441 representing NM_000727
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCCAGACCAAAATGCTGAAGGTCCGCGTGACCCTCTTCTGCATCCTGGCAGGCATCGTGCTGGCCA
  TGACAGCCGTGGTAACCGACCACTGGGCTGTGCTGAGCCCCCACATGGAGCACCACAACACTACCTGCGA
  GGCGGCCCACTTCGGCCTCTGGCGGATTTGTACCAAGCGCATCCCCATGGACGACAGCAAGACCTGCGGG
  CCCATCACCCTGCCCGGGGAGAAGAACTGTTCCTACTTCAGGCATTTTAACCCCGGCGAGAGCTCGGAGA
  TCTTCGAATTCACCACTCAGAAGGAGTACAGCATCTCGGCAGCCGCCATCGCCATCTTCAGCCTTGGCTT
  CATCATCCTGGGCAGCCTCTGTGTCCTCCTGTCCCTCGGGAAGAAGAGGGACTATCTGCTGCGACCCGCG
  TCCATGTTCTATGCCTTTGCAGGTCTCTGCATCCTCGTCTCGGTGGAGGTCATGCGGCAGTCGGTGAAGC
  GCATGATTGACAGTGAGGACACCGTCTGGATCGAGTACTATTACTCCTGGTCCTTTGCCTGCGCCTGTGC
  CGCCTTCATCCTCCTCTTTCTCGGCGGTCTCGCCCTCCTGCTGTTCTCCCTGCCTCGAATGCCCCGGAAC
  CCATGGGAGTCCTGCATGGATGCTGAGCCCGAGCAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214441 representing NM_000727
  Red=Cloning site Green=Tags(s)
  
  MSQTKMLKVRVTLFCILAGIVLAMTAVVTDHWAVLSPHMEHHNTTCEAAHFGLWRICTKRIPMDDSKTCG
  PITLPGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAIAIFSLGFIILGSLCVLLSLGKKRDYLLRPA
  SMFYAFAGLCILVSVEVMRQSVKRMIDSEDTVWIEYYYSWSFACACAAFILLFLGGLALLLFSLPRMPRN
  PWESCMDAEPEH
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_000727
• ORF Size: 666 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_000727.4
• RefSeq Size: 1266 bp
• RefSeq ORF: 669 bp
• Locus ID: 786
• UniProt ID: Q06432
• Cytogenetics: 17q24.2
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane
• Protein Pathways: Arrhythmogenic right ventricular cardiomyopathy (ARVC), Cardiac muscle contraction, Dilated cardiomyopathy, Hypertrophic cardiomyopathy (HCM), MAPK signaling pathway
• MW: 24.8 kDa
• Gene Summary: Voltage-dependent calcium channels are composed of five subunits. The protein encoded by this gene represents one of these subunits, gamma, and is one of two known gamma subunit proteins. This particular gamma subunit is part of skeletal muscle 1,4-dihydropyridine-sensitive calcium channels and is an integral membrane protein that plays a role in excitation-contraction coupling. This gene is part of a functionally diverse eight-member protein subfamily of the PMP-22/EMP/MP20 family and is located in a cluster with two family members that function as transmembrane AMPA receptor regulatory proteins (TARPs). [provided by RefSeq, Dec 2010]