CHES1(FOXN3) (NM_001085471) Human Tagged ORF Clone

CAT#: RC214368

FOXN3 (Myc-DDK-tagged)-Human forkhead box N3 (FOXN3), transcript variant 1

Clone Modification / Custom Cloning Service

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CHES1(FOXN3) (NM_001085471) Human Tagged ORF Clone
Symbol FOXN3
Synonyms C14orf116; CHES1; PRO1635
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214368 representing NM_001085471
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTCCAGTCATGCCTCCCAGTAAGAAGCCAGAAAGCTCAGGAATTAGTGTCTCCAGTGGACTGAGTC
AGTGTTACGGGGGCAGCGGTTTCTCCAAGGCCCTTCAGGAAGACGATGACCTCGACTTTTCTCTGCCTGA
CATCCGATTAGAAGAGGGGGCCATGGAAGATGAAGAGCTGACCAACCTGAACTGGCTGCACGAGAGCAAG
AACTTGCTGAAGAGCTTTGGGGAGTCGGTCCTCAGGAGTGTCAGCCCCGTCCAGGACCTGGACGATGACA
CCCCCCCATCCCCTGCCCACTCTGACATGCCCTACGATGCCAGGCAGAACCCCAACTGCAAACCCCCCTA
CTCCTTCAGCTGCCTCATATTTATGGCCATCGAGGACTCTCCAACCAAGCGCCTGCCAGTGAAGGATATC
TACAACTGGATCTTGGAACATTTTCCGTATTTTGCAAATGCACCTACTGGGTGGAAAAACTCAGTGAGAC
ACAATTTATCATTGAATAAGTGTTTTAAGAAAGTGGACAAAGAGAGGAGTCAGAGTATTGGGAAAGGGTC
GTTGTGGTGCATAGACCCAGAGTATAGACAAAATCTAATTCAGGCTTTGAAAAAGACACCTTATCACCCA
CACCCACACGTGTTCAATACACCTCCCACCTGTCCTCAGGCATATCAAAGCACATCAGGTCCACCCATCT
GGCCGGGCAGTACCTTCTTCAAGAGAAATGGAGCCCTTCTCCAAGATCCTGACATTGATGCTGCCAGTGC
CATGATGCTTTTGAATACTCCCCCTGAGATACAAGCAGGTTTTCCTCCAGGAGTGATCCAAAATGGAGCG
CGGGTCCTGAGCCGAGGGCTGTTTCCTGGCGTGCGGCCGCTGCCAATCACTCCCATTGGGGTGACAGCGG
CCATGAGGAATGGCATCACCAGCTGCCGGATGCGGACTGAGAGTGAGCCATCTTGTGGCTCCCCAGTGGT
CAGCGGAGACCCCAAGGAGGATCACAACTACAGCAGTGCCAAGTCCTCCAACGCCCGGAGCACCTCGCCC
ACCAGCGACTCCATCTCCTCCTCCTCCTCCTCAGCCGACGACCACTATGAGTTTGCCACCAAGGGGAGCC
AGGAGGGCAGCGAGGGCAGCGAGGGGAGCTTCCGGAGCCACGAGAGCCCCAGCGACACGGAAGAGGACGA
CAGGAAGCACAGCCAGAAGGAGCCCAAGGATTCTCTGGGGGACAGCGGGTACGCATCCCAGCACAAGAAG
CGCCAGCACTTCGCCAAGGCCAGGAAGGTCCCCAGCGACACACTGCCCCTCAAAAAGAGACGCACCGAAA
AGCCCCCCGAGAGCGATGATGAGGAGATGAAAGAAGCGGCAGGGTCCCTCCTGCACTTAGCAGGGATCCG
GTCCTGTTTGAATAACATCACCAATCGGACGGCAAAGGGGCAGAAAGAGCAAAAGGAAACCACAAAAAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214368 representing NM_001085471
Red=Cloning site Green=Tags(s)

MGPVMPPSKKPESSGISVSSGLSQCYGGSGFSKALQEDDDLDFSLPDIRLEEGAMEDEELTNLNWLHESK
NLLKSFGESVLRSVSPVQDLDDDTPPSPAHSDMPYDARQNPNCKPPYSFSCLIFMAIEDSPTKRLPVKDI
YNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCIDPEYRQNLIQALKKTPYHP
HPHVFNTPPTCPQAYQSTSGPPIWPGSTFFKRNGALLQDPDIDAASAMMLLNTPPEIQAGFPPGVIQNGA
RVLSRGLFPGVRPLPITPIGVTAAMRNGITSCRMRTESEPSCGSPVVSGDPKEDHNYSSAKSSNARSTSP
TSDSISSSSSSADDHYEFATKGSQEGSEGSEGSFRSHESPSDTEEDDRKHSQKEPKDSLGDSGYASQHKK
RQHFAKARKVPSDTLPLKKRRTEKPPESDDEEMKEAAGSLLHLAGIRSCLNNITNRTAKGQKEQKETTKN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001085471
ORF Size 1470 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001085471.1, NP_001078940
RefSeq Size 7856
RefSeq ORF 1473
Locus ID 1112
Cytogenetics 14q31.3-q32.11
Protein Families Transcription Factors, Druggable Genome
MW 53.7 kDa
Gene Summary This gene is a member of the forkhead/winged helix transcription factor family. Checkpoints are eukaryotic DNA damage-inducible cell cycle arrests at G1 and G2. Checkpoint suppressor 1 suppresses multiple yeast checkpoint mutations including mec1, rad9, rad53 and dun1 by activating a MEC1-independent checkpoint pathway. Alternative splicing is observed at the locus, resulting in distinct isoforms. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations