ADCY7 (NM_001114) Human Tagged ORF Clone

CAT#: RC214351

Reviews ()
Write a review
  • TrueORF®

ADCY7 (Myc-DDK-tagged)-Human adenylate cyclase 7 (ADCY7)



  "NM_001114" in other vectors (6)

USD 600.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ADCY7 (NM_001114) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ADCY7
Synonyms AC7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC214351 representing NM_001114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCCAAGGGGCGCTACTTCCTCAACGAGGGCGAGGAGGGCCCTGACCAAGATGCGCTCTACGAGA
AGTACCAGCTCACCAGCCAGCATGGGCCGCTGCTGCTCACGCTCCTGCTGGTGGCCGCCACTGCCTGCGT
GGCCCTCATCATCATTGCCTTCAGCCAGGGGGACCCCTCCAGACACCAGGCCATTCTGGGCATGGCGTTC
CTGGTGCTGGCGGTGTTTGCGGCCCTCTCTGTGCTGATGTACGTCGAGTGTCTCCTGCGGCGCTGGCTCA
GGGCCTTGGCGCTGCTCACCTGGGCCTGCTTGGTGGCGCTGGGCTATGTGCTGGTGTTCGACGCATGGAC
AAAGGCGGCCTGTGCGTGGGAGCAGGTGCCCTTCTTCCTGTTCATTGTCTTCGTGGTGTACACACTACTG
CCCTTCAGCATGCGGGGCGCTGTCGCCGTTGGGGCCGTCTCCACTGCCTCCCACCTCCTGGTGCTCGGTT
CTTTGATGGGAGGCTTCACGACACCCAGTGTCCGGGTGGGGCTGCAGCTGCTGGCCAACGCAGTCATCTT
CCTGTGTGGGAACCTGACAGGCGCCTTCCACAAGCACCAAATGCAGGATGCGTCCCGGGACCTCTTCACC
TACACTGTGAAGTGCATCCAGATCCGCCGGAAGCTGCGCATCGAGAAGCGCCAGCAGGAGAACCTGCTGC
TGTCAGTGCTTCCGGCCCACATCTCCATGGGCATGAAGCTGGCCATCATCGAACGGCTCAAGGAGCATGG
TGACCGTCGCTGCATGCCTGACAACAACTTCCACAGCCTCTACGTCAAGAGGCACCAGAATGTCAGCATC
CTCTATGCGGACATCGTGGGCTTCACGCAGCTGGCCAGCGACTGTTCTCCCAAGGAGCTGGTGGTGGTGC
TGAATGAGCTCTTTGGCAAGTTCGACCAGATCGCCAAGGCCAACGAGTGCATGCGAATCAAGATCCTCGG
CGACTGCTACTACTGTGTATCGGGCCTGCCCGTGTCGCTGCCTACCCACGCCCGGAACTGCGTGAAGATG
GGGCTGGACATGTGCCAGGCCATCAAGCAGGTGCGGGAGGCCACGGGCGTGGACATCAACATGCGTGTGG
GCATACACTCGGGGAATGTGCTGTGCGGGGTCATCGGGCTGCGCAAGTGGCAGTATGACGTGTGGTCCCA
CGACGTGTCCCTGGCCAACCGGATGGAGGCAGCCGGAGTACCCGGCCGGGTGCACATCACGGAGGCCACG
CTAAAGCACCTGGACAAGGCGTACGAGGTGGAGGATGGGCACGGGCAGCAGCGGGACCCCTACCTCAAGG
AGATGAACATCCGCACCTACCTGGTCATCGACCCCCGGAGCCAGCAGCCACCCCCGCCCAGCCAACACCT
CCCCAGGCCCAAGGGGGACGCGGCCCTGAAGATGCGGGCGTCAGTGCGCATGACCCGGTACCTCGAGTCC
TGGGGGGCGGCACGGCCCTTTGCACATCTCAACCACCGTGAGAGCGTGAGCAGTGGTGAGACCCACGTCC
CCAACGGGCGGAGGCCTAAGAGCGTTCCCCAGCGCCACCGCCGGACCCCAGACAGAAGCATGTCCCCCAA
GGGGCGGTCGGAGGATGACTCGTACGATGACGAGATGCTGTCAGCCATTGAGGGGCTCAGCTCCACGAGG
CCCTGCTGCTCCAAGTCCGATGACTTCTACACCTTTGGGTCCATCTTCCTGGAGAAGGGCTTTGAGCGCG
AGTACCGCCTGGCACCCATCCCCCGGGCCCGCCACGACTTTGCCTGCGCCAGCCTGATCTTCGTCTGCAT
CCTGCTCGTCCATGTCCTGCTCATGCCCAGGACGGCGGCACTGGGTGTGTCCTTCGGGCTGGTGGCCTGT
GTACTGGGGCTGGTGCTGGGCCTGTGCTTTGCCACCAAGTTCTCGAGGTGCTGCCCAGCTCGGGGGACGC
TCTGCACTATCTCTGAGAGGGTGGAGACACAGCCCCTGCTGAGGCTGACCCTGGCCGTCCTGACCATCGG
CAGCCTGCTCACTGTGGCCATCATCAACCTGCCCCTGATGCCTTTCCAAGTTCCAGAGCTGCCTGTTGGC
AATGAGACAGGCCTACTGGCCGCGAGCAGCAAGACAAGAGCCCTGTGTGAGCCCCTCCCGTACTACACCT
GCAGCTGTGTCCTGGGCTTCATCGCCTGCTCGGTCTTCCTGAGGATGAGCCTGGAGCCAAAGGTTGTGCT
GCTGACAGTGGCCCTGGTGGCCTACCTGGTGCTCTTCAACCTCTCCCCATGCTGGCAGTGGGACTGCTGC
GGCCAAGGCCTGGGCAACCTCACCAAGCCCAACGGCACCACCAGTGGCACCCCTAGCTGTTCCTGGAAGG
ACCTGAAGACCATGACCAATTTCTACCTGGTCCTGTTCTACATCACCCTGCTTACACTCTCCAGACAGAT
TGACTATTACTGCCGCTTGGACTGCCTATGGAAGAAGAAGTTCAAGAAGGAGCACGAGGAGTTTGAGACC
ATGGAGAACGTGAACCGCCTTCTTCTGGAGAACGTCCTGCCAGCCCACGTGGCTGCCCACTTTATCGGTG
ACAAGTTAAACGAGGACTGGTACCATCAGTCCTATGACTGCGTCTGTGTCATGTTTGCCTCCGTGCCGGA
CTTCAAAGTGTTCTACACAGAGTGCGATGTCAACAAAGAAGGGCTGGAGTGCCTACGCCTGCTCAATGAG
ATCATTGCCGACTTCGACGAGCTCCTACTGAAGCCCAAGTTCAGCGGCGTGGAGAAGATCAAGACCATCG
GCAGCACGTACATGGCAGCTGCAGGGCTCAGCGTCGCCTCAGGGCACGAGAACCAGGAGCTGGAGCGGCA
GCATGCCCACATTGGTGTCATGGTGGAGTTCAGCATCGCCCTGATGAGTAAGCTGGACGGCATCAACAGG
CACTCCTTCAACTCCTTCCGCCTCCGCGTCGGCATAAACCATGGGCCTGTGATTGCTGGAGTGATTGGGG
CCCGAAAACCTCAGTATGACATCTGGGGAAACACTGTCAATGTGGCCAGCCGAATGGAAAGCACTGGAGA
ACTTGGGAAAATCCAGGTTACCGAGGAGACCTGCACCATCCTCCAGGGCCTCGGGTACTCTTGTGAATGC
CGTGGCCTGATCAACGTCAAAGGCAAAGGCGAGCTGAGGACTTACTTTGTCTGTACGGACACTGCCAAGT
TTCAGGGGCTGGGGCTGAAC


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
>RC214351 representing NM_001114
Red=Cloning site Green=Tags(s)

MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPSRHQAILGMAF
LVLAVFAALSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAACAWEQVPFFLFIVFVVYTLL
PFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVRVGLQLLANAVIFLCGNLTGAFHKHQMQDASRDLFT
YTVKCIQIRRKLRIEKRQQENLLLSVLPAHISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSI
LYADIVGFTQLASDCSPKELVVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKM
GLDMCQAIKQVREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRASVRMTRYLES
WGAARPFAHLNHRESVSSGETHVPNGRRPKSVPQRHRRTPDRSMSPKGRSEDDSYDDEMLSAIEGLSSTR
PCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACASLIFVCILLVHVLLMPRTAALGVSFGLVAC
VLGLVLGLCFATKFSRCCPARGTLCTISERVETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVG
NETGLLAASSKTRALCEPLPYYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCC
GQGLGNLTKPNGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKEGLECLRLLNE
IIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAHIGVMVEFSIALMSKLDGINR
HSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVASRMESTGELGKIQVTEETCTILQGLGYSCEC
RGLINVKGKGELRTYFVCTDTAKFQGLGLN

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001114
ORF Size 3240 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001114.1, NM_001114.2, NM_001114.3, NM_001114.4, NP_001105.1
RefSeq Size 6157 bp
RefSeq ORF 3243 bp
Locus ID 113
Cytogenetics 16q12.1
Domains CYCc
Protein Families Druggable Genome, Transmembrane
Protein Pathways Calcium signaling pathway, Chemokine signaling pathway, Dilated cardiomyopathy, Gap junction, GnRH signaling pathway, Melanogenesis, Oocyte meiosis, Progesterone-mediated oocyte maturation, Purine metabolism, Vascular smooth muscle contraction
MW 120.1 kDa
Gene Summary This gene encodes a membrane-bound adenylate cyclase that catalyses the formation of cyclic AMP from ATP and is inhibitable by calcium. The product of this gene is a member of the adenylyl cyclase class-4/guanylyl cyclase enzyme family that is characterized by the presence of twelve membrane-spanning domains in its sequences. Several transcript variants have been observed for this gene, but the full-length natures of only two have been determined so far. [provided by RefSeq, Oct 2013]

Citations (1)

Other Versions

Other products for "ADCY7"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Anti-ADCY7 Rabbit Polyclonal Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools