DNASE2B (NM_058248) Human Tagged ORF Clone

CAT#: RC214291

DNASE2B (Myc-DDK-tagged)-Human deoxyribonuclease II beta (DNASE2B), transcript variant 2

Product Images

Circular map for RC214291

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: DNASE2B
• Synonyms: DLAD
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC214291 representing NM_058248
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGCCCCAGCTGTGCACCAGGGCCAGCTCATCAGAGATTCCTGGCAGGCTCCTCACCACACTTCAGTCGG
  CCCAGGGACAAAAATTCCTCCATTTTGCAAAGTCGGATTCTTTTCTTGACGACATCTTTGCAGCCTGGAT
  GGCTCAACGGCTGAAGACACACTTGTTAACAGAAACCTGGCAGCGAAAAAGACAAGAGCTTCCTTCAAAC
  TGCTCCCTTCCTTACCATGTCTACAATATAAAAGCAATTAAATTATCACGACACTCTTATTTCAGTTCTT
  ATCAAGATCATGCCAAGTGGTGTATTTCCCAAAAGGGCACCAAAAATCGCTGGACATGTATTGGAGACCT
  AAATCGGAGTCCACACCAAGCCTTCAGAAGTGGAGGATTCATTTGTACCCAGAATTGGCAAATTTACCAA
  GCATTTCAAGGATTAGTATTATACTATGAAAGCTGTAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC214291 representing NM_058248
  Red=Cloning site Green=Tags(s)
  
  MPQLCTRASSSEIPGRLLTTLQSAQGQKFLHFAKSDSFLDDIFAAWMAQRLKTHLLTETWQRKRQELPSN
  CSLPYHVYNIKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGGFICTQNWQIYQ
  AFQGLVLYYESCK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_058248
• ORF Size: 459 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_058248.1, NP_490649.1
• RefSeq Size: 1029 bp
• RefSeq ORF: 462 bp
• Locus ID: 58511
• UniProt ID: Q8WZ79
• Cytogenetics: 1p31.1-p22.3
• Protein Families: Transmembrane
• Protein Pathways: Lysosome
• MW: 17.8 kDa
• Gene Summary: The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]