CYP2A13 (NM_000766) Human Tagged ORF Clone

CAT#: RC214289

CYP2A13 (Myc-DDK-tagged)-Human cytochrome P450, family 2, subfamily A, polypeptide 13 (CYP2A13)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 629.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYP2A13 (NM_000766) Human Tagged ORF Clone
Symbol CYP2A13
Synonyms CPAD; CYP2A; CYPIIA13
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214289 representing NM_000766
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGCCTCAGGGCTGCTTCTGGTGACCTTGCTGGCCTGCCTGACTGTGATGGTCTTGATGTCAGTCT
GGCGGCAGAGGAAGAGCAGGGGGAAGCTGCCTCCGGGACCCACCCCATTGCCCTTCATTGGAAACTACCT
GCAGCTGAACACAGAGCAGATGTACAACTCCCTCATGAAGATCAGTGAGCGCTATGGCCCTGTGTTCACC
ATTCACTTGGGGCCCCGGCGGGTCGTGGTGCTGTGCGGACATGATGCCGTCAAGGAGGCTCTGGTGGACC
AGGCTGAGGAGTTCAGCGGGCGAGGCGAGCAGGCCACCTTCGACTGGCTCTTCAAAGGCTATGGCGTGGC
GTTCAGCAACGGGGAGCGCGCCAAGCAGCTCCGGCGCTTCTCCATCGCCACCCTAAGGGGTTTTGGCGTG
GGCAAGCGCGGCATCGAGGAACGCATCCAGGAGGAGGCGGGCTTCCTCATCGACGCCCTCCGGGGCACGC
ACGGCGCCAATATCGATCCCACCTTCTTCCTGAGCCGCACAGTCTCCAATGTCATCAGCTCCATTGTCTT
TGGGGACCGCTTTGACTATGAGGACAAAGAGTTCCTGTCACTGTTGCGCATGATGCTGGGAAGCTTCCAG
TTCACGGCAACCTCCACGGGGCAGCTCTATGAGATGTTCTCTTCGGTGATGAAACACCTGCCAGGACCAC
AGCAACAGGCCTTTAAGGAGCTGCAAGGGCTGGAGGACTTCATCGCCAAGAAGGTGGAGCACAACCAGCG
CACGCTGGATCCCAATTCCCCACGGGACTTCATCGACTCCTTTCTCATCCGCATGCAGGAGGAGGAGAAG
AACCCCAACACAGAGTTCTACTTGAAGAACCTGGTGATGACCACCCTGAACCTCTTCTTTGCGGGCACTG
AGACCGTGAGCACCACCCTGCGCTACGGTTTCCTGCTGCTCATGAAGCACCCAGAGGTGGAGGCCAAGGT
CCATGAGGAGATTGACAGAGTGATCGGCAAGAACCGGCAGCCCAAGTTTGAGGACCGGGCCAAGATGCCC
TACACAGAGGCAGTGATCCACGAGATCCAAAGATTTGGAGACATGCTCCCCATGGGTTTGGCCCACAGGG
TCAACAAGGACACCAAGTTTCGGGATTTCTTCCTCCCTAAGGGCACTGAAGTGTTCCCTATGCTGGGCTC
CGTGCTGAGAGACCCCAGGTTCTTCTCCAACCCCCGGGACTTCAATCCCCAGCACTTCCTGGATAAGAAG
GGGCAGTTTAAGAAGAGTGATGCTTTTGTGCCCTTTTCCATCGGAAAGCGGTACTGTTTTGGAGAAGGCC
TGGCCAGAATGGAGCTCTTTCTCTTCTTCACCACCATCATGCAGAACTTTCGCTTCAAGTCCCCTCAGTC
GCCTAAGGATATCGACGTGTCCCCCAAACACGTGGGCTTTGCCACGATCCCACGAAACTACACCATGAGC
TTCCTGCCCCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214289 representing NM_000766
Red=Cloning site Green=Tags(s)

MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFT
IHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGV
GKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQ
FTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEK
NPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMP
YTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMS
FLPR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000766
ORF Size 1482 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000766.1, NM_000766.2, NM_000766.3, NM_000766.4, NP_000757
RefSeq Size 1747
RefSeq ORF 1485
Locus ID 1553
Cytogenetics 19q13.2
Protein Families Transmembrane, Druggable Genome
Protein Pathways Caffeine metabolism, Retinol metabolism, Drug metabolism - cytochrome P450, Drug metabolism - other enzymes, Metabolic pathways
MW 56.5 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)