FLT4 (NM_182925) Human Tagged ORF Clone

CAT#: RC214285

FLT4 (Myc-DDK-tagged)-Human fms-related tyrosine kinase 4 (FLT4), transcript variant 1

Change vector?

USD 1,999


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name FLT4 (NM_182925) Human Tagged ORF Clone
Symbol FLT4
Synonyms FLT-4; FLT41; LMPH1A; PCL; VEGFR-3; VEGFR3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214285 representing NM_182925
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCGGGGCGCCGCGCTGTGCCTGCGACTGTGGCTCTGCCTGGGACTCCTGGACGGCCTGGTGAGTG
GCTACTCCATGACCCCCCCGACCTTGAACATCACGGAGGAGTCACACGTCATCGACACCGGTGACAGCCT
GTCCATCTCCTGCAGGGGACAGCACCCCCTCGAGTGGGCTTGGCCAGGAGCTCAGGAGGCGCCAGCCACC
GGAGACAAGGACAGCGAGGACACGGGGGTGGTGCGAGACTGCGAGGGCACAGACGCCAGGCCCTACTGCA
AGGTGTTGCTGCTGCACGAGGTACATGCCAACGACACAGGCAGCTACGTCTGCTACTACAAGTACATCAA
GGCACGCATCGAGGGCACCACGGCCGCCAGCTCCTACGTGTTCGTGAGAGACTTTGAGCAGCCATTCATC
AACAAGCCTGACACGCTCTTGGTCAACAGGAAGGACGCCATGTGGGTGCCCTGTCTGGTGTCCATCCCCG
GCCTCAATGTCACGCTGCGCTCGCAAAGCTCGGTGCTGTGGCCAGACGGGCAGGAGGTGGTGTGGGATGA
CCGGCGGGGCATGCTCGTGTCCACGCCACTGCTGCACGATGCCCTGTACCTGCAGTGCGAGACCACCTGG
GGAGACCAGGACTTCCTTTCCAACCCCTTCCTGGTGCACATCACAGGCAACGAGCTCTATGACATCCAGC
TGTTGCCCAGGAAGTCGCTGGAGCTGCTGGTAGGGGAGAAGCTGGTCCTGAACTGCACCGTGTGGGCTGA
GTTTAACTCAGGTGTCACCTTTGACTGGGACTACCCAGGGAAGCAGGCAGAGCGGGGTAAGTGGGTGCCC
GAGCGACGCTCCCAGCAGACCCACACAGAACTCTCCAGCATCCTGACCATCCACAACGTCAGCCAGCACG
ACCTGGGCTCGTATGTGTGCAAGGCCAACAACGGCATCCAGCGATTTCGGGAGAGCACCGAGGTCATTGT
GCATGAAAATCCCTTCATCAGCGTCGAGTGGCTCAAAGGACCCATCCTGGAGGCCACGGCAGGAGACGAG
CTGGTGAAGCTGCCCGTGAAGCTGGCAGCGTACCCCCCGCCCGAGTTCCAGTGGTACAAGGATGGAAAGG
CACTGTCCGGGCGCCACAGTCCACATGCCCTGGTGCTCAAGGAGGTGACAGAGGCCAGCACAGGCACCTA
CACCCTCGCCCTGTGGAACTCCGCTGCTGGCCTGAGGCGCAACATCAGCCTGGAGCTGGTGGTGAATGTG
CCCCCCCAGATACATGAGAAGGAGGCCTCCTCCCCCAGCATCTACTCGCGTCACAGCCGCCAGGCCCTCA
CCTGCACGGCCTACGGGGTGCCCCTGCCTCTCAGCATCCAGTGGCACTGGCGGCCCTGGACACCCTGCAA
GATGTTTGCCCAGCGTAGTCTCCGGCGGCGGCAGCAGCAAGACCTCATGCCACAGTGCCGTGACTGGAGG
GCGGTGACCACGCAGGATGCCGTGAACCCCATCGAGAGCCTGGACACCTGGACCGAGTTTGTGGAGGGAA
AGAATAAGACTGTGAGCAAGCTGGTGATCCAGAATGCCAACGTGTCTGCCATGTACAAGTGTGTGGTCTC
CAACAAGGTGGGCCAGGATGAGCGGCTCATCTACTTCTATGTGACCACCATCCCCGACGGCTTCACCATC
GAATCCAAGCCATCCGAGGAGCTACTAGAGGGCCAGCCGGTGCTCCTGAGCTGCCAAGCCGACAGCTACA
AGTACGAGCATCTGCGCTGGTACCGCCTCAACCTGTCCACGCTGCACGATGCGCACGGGAACCCGCTTCT
GCTCGACTGCAAGAACGTGCATCTGTTCGCCACCCCTCTGGCCGCCAGCCTGGAGGAGGTGGCACCTGGG
GCGCGCCACGCCACGCTCAGCCTGAGTATCCCCCGCGTCGCGCCCGAGCACGAGGGCCACTATGTGTGCG
AAGTGCAAGACCGGCGCAGCCATGACAAGCACTGCCACAAGAAGTACCTGTCGGTGCAGGCCCTGGAAGC
CCCTCGGCTCACGCAGAACTTGACCGACCTCCTGGTGAACGTGAGCGACTCGCTGGAGATGCAGTGCTTG
GTGGCCGGAGCGCACGCGCCCAGCATCGTGTGGTACAAAGACGAGAGGCTGCTGGAGGAAAAGTCTGGAG
TCGACTTGGCGGACTCCAACCAGAAGCTGAGCATCCAGCGCGTGCGCGAGGAGGATGCGGGACGCTATCT
GTGCAGCGTGTGCAACGCCAAGGGCTGCGTCAACTCCTCCGCCAGCGTGGCCGTGGAAGGCTCCGAGGAT
AAGGGCAGCATGGAGATCGTGATCCTTGTCGGTACCGGCGTCATCGCTGTCTTCTTCTGGGTCCTCCTCC
TCCTCATCTTCTGTAACATGAGGAGGCCGGCCCACGCAGACATCAAGACGGGCTACCTGTCCATCATCAT
GGACCCCGGGGAGGTGCCTCTGGAGGAGCAATGCGAATACCTGTCCTACGATGCCAGCCAGTGGGAATTC
CCCCGAGAGCGGCTGCACCTGGGGAGAGTGCTCGGCTACGGCGCCTTCGGGAAGGTGGTGGAAGCCTCCG
CTTTCGGCATCCACAAGGGCAGCAGCTGTGACACCGTGGCCGTGAAAATGCTGAAAGAGGGCGCCACGGC
CAGCGAGCACCGCGCGCTGATGTCGGAGCTCAAGATCCTCATTCACATCGGCAACCACCTCAACGTGGTC
AACCTCCTCGGGGCGTGCACCAAGCCGCAGGGCCCCCTCATGGTGATCGTGGAGTTCTGCAAGTACGGCA
ACCTCTCCAACTTCCTGCGCGCCAAGCGGGACGCCTTCAGCCCCTGCGCGGAGAAGTCTCCCGAGCAGCG
CGGACGCTTCCGCGCCATGGTGGAGCTCGCCAGGCTGGATCGGAGGCGGCCGGGGAGCAGCGACAGGGTC
CTCTTCGCGCGGTTCTCGAAGACCGAGGGCGGAGCGAGGCGGGCTTCTCCAGACCAAGAAGCTGAGGACC
TGTGGCTGAGCCCGCTGACCATGGAAGATCTTGTCTGCTACAGCTTCCAGGTGGCCAGAGGGATGGAGTT
CCTGGCTTCCCGAAAGTGCATCCACAGAGACCTGGCTGCTCGGAACATTCTGCTGTCGGAAAGCGACGTG
GTGAAGATCTGTGACTTTGGCCTTGCCCGGGACATCTACAAAGACCCTGACTACGTCCGCAAGGGCAGTG
CCCGGCTGCCCCTGAAGTGGATGGCCCCTGAAAGCATCTTCGACAAGGTGTACACCACGCAGAGTGACGT
GTGGTCCTTTGGGGTGCTTCTCTGGGAGATCTTCTCTCTGGGGGCCTCCCCGTACCCTGGGGTGCAGATC
AATGAGGAGTTCTGCCAGCGGCTGAGAGACGGCACAAGGATGAGGGCCCCGGAGCTGGCCACTCCCGCCA
TACGCCGCATCATGCTGAACTGCTGGTCCGGAGACCCCAAGGCGAGACCTGCATTCTCGGAGCTGGTGGA
GATCCTGGGGGACCTGCTCCAGGGCAGGGGCCTGCAAGAGGAAGAGGAGGTCTGCATGGCCCCGCGCAGC
TCTCAGAGCTCAGAAGAGGGCAGCTTCTCGCAGGTGTCCACCATGGCCCTACACATCGCCCAGGCTGACG
CTGAGGACAGCCCGCCAAGCCTGCAGCGCCACAGCCTGGCCGCCAGGTATTACAACTGGGTGTCCTTTCC
CGGGTGCCTGGCCAGAGGGGCTGAGACCCGTGGTTCCTCCAGGATGAAGACATTTGAGGAATTCCCCATG
ACCCCAACGACCTACAAAGGCTCTGTGGACAACCAGACAGACAGTGGGATGGTGCTGGCCTCGGAGGAGT
TTGAGCAGATAGAGAGCAGGCATAGACAAGAAAGCGGCTTCAGCTGTAAAGGACCTGGCCAGAATGTGGC
TGTGACCAGGGCACACCCTGACTCCCAAGGGAGGCGGCGGCGGCCTGAGCGGGGGGCCCGAGGAGGCCAG
GTGTTTTACAACAGCGAGTATGGGGAGCTGTCGGAGCCAAGCGAGGAGGACCACTGCTCCCCGTCTGCCC
GCGTGACTTTCTTCACAGACAACAGCTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214285 representing NM_182925
Red=Cloning site Green=Tags(s)

MQRGAALCLRLWLCLGLLDGLVSGYSMTPPTLNITEESHVIDTGDSLSISCRGQHPLEWAWPGAQEAPAT
GDKDSEDTGVVRDCEGTDARPYCKVLLLHEVHANDTGSYVCYYKYIKARIEGTTAASSYVFVRDFEQPFI
NKPDTLLVNRKDAMWVPCLVSIPGLNVTLRSQSSVLWPDGQEVVWDDRRGMLVSTPLLHDALYLQCETTW
GDQDFLSNPFLVHITGNELYDIQLLPRKSLELLVGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVP
ERRSQQTHTELSSILTIHNVSQHDLGSYVCKANNGIQRFRESTEVIVHENPFISVEWLKGPILEATAGDE
LVKLPVKLAAYPPPEFQWYKDGKALSGRHSPHALVLKEVTEASTGTYTLALWNSAAGLRRNISLELVVNV
PPQIHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIQWHWRPWTPCKMFAQRSLRRRQQQDLMPQCRDWR
AVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQDERLIYFYVTTIPDGFTI
ESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHGNPLLLDCKNVHLFATPLAASLEEVAPG
ARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCL
VAGAHAPSIVWYKDERLLEEKSGVDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSED
KGSMEIVILVGTGVIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGYGAFGKVVEASAFGIHKGSSCDTVAVKMLKEGATASEHRALMSELKILIHIGNHLNVV
NLLGACTKPQGPLMVIVEFCKYGNLSNFLRAKRDAFSPCAEKSPEQRGRFRAMVELARLDRRRPGSSDRV
LFARFSKTEGGARRASPDQEAEDLWLSPLTMEDLVCYSFQVARGMEFLASRKCIHRDLAARNILLSESDV
VKICDFGLARDIYKDPDYVRKGSARLPLKWMAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQI
NEEFCQRLRDGTRMRAPELATPAIRRIMLNCWSGDPKARPAFSELVEILGDLLQGRGLQEEEEVCMAPRS
SQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPM
TPTTYKGSVDNQTDSGMVLASEEFEQIESRHRQESGFSCKGPGQNVAVTRAHPDSQGRRRRPERGARGGQ
VFYNSEYGELSEPSEEDHCSPSARVTFFTDNSY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_182925
ORF Size 4089 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_182925.2, NM_182925.3, NM_182925.4, NP_891555
RefSeq Size 4776
RefSeq ORF 4092
Locus ID 2324
Cytogenetics 5q35.3
Protein Families Protein Kinase, Transmembrane, Druggable Genome
Protein Pathways Cytokine-cytokine receptor interaction, Focal adhesion
MW 150.2 kDa
Gene Summary This gene encodes a tyrosine kinase receptor for vascular endothelial growth factors C and D. The protein is thought to be involved in lymphangiogenesis and maintenance of the lymphatic endothelium. Mutations in this gene cause hereditary lymphedema type IA. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations