NCALD (NM_001040626) Human Tagged ORF Clone

CAT#: RC214160

Reviews ()
Write a review

NCALD (Myc-DDK-tagged)-Human neurocalcin delta (NCALD), transcript variant 3

  View "NM_001040626" in other vectors (6)

USD 420.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name NCALD (NM_001040626) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol NCALD
Synonyms MGC33870; MGC74858
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC214160 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAAACAGAACAGCAAGCTGCGCCCGGAGGTCATGCAGGACTTGCTGGAAAGCACAGACTTTACAG
AGCATGAGATCCAGGAATGGTATAAAGGCTTCTTGAGAGACTGCCCCAGTGGACATTTGTCAATGGAAGA
GTTTAAGAAAATATATGGGAACTTTTTCCCTTATGGGGATGCTTCCAAATTTGCAGAGCATGTCTTCCGC
ACCTTCGATGCAAATGGAGATGGGACAATAGACTTTAGAGAATTCATCATCGCCTTGAGTGTAACTTCGA
GGGGGAAGCTGGAGCAGAAGCTGAAATGGGCCTTCAGCATGTACGACCTGGACGGAAATGGCTATATCAG
CAAGGCAGAGATGCTAGAGATCGTGCAGGCAATCTATAAGATGGTTTCCTCTGTAATGAAAATGCCTGAA
GATGAGTCAACCCCAGAGAAAAGAACAGAAAAGATCTTCCGCCAGATGGACACCAATAGAGACGGAAAAC
TCTCCATGGAAGAGTTCATCCGAGGAGCCAAAAGCGACCCGTCCATTGTGCGCCTCCTGCAGTGCGACCC
GAGCAGTGCCGGCCAGTTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214160 protein sequence
Red=Cloning site Green=Tags(s)

MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFR
TFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPE
DESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001040626
ORF Size 579 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001040626.1, NP_001035716.1
RefSeq Size 3673
RefSeq ORF 582
Locus ID 83988
Cytogenetics 8q22.3
MW 22.3 kDa
Gene Summary This gene encodes a member of the neuronal calcium sensor (NCS) family of calcium-binding proteins. The protein contains an N-terminal myristoylation signal and four EF-hand calcium binding loops. The protein is cytosolic at resting calcium levels; however, elevated intracellular calcium levels induce a conformational change that exposes the myristoyl group, resulting in protein association with membranes and partial co-localization with the perinuclear trans-golgi network. The protein is thought to be a regulator of G protein-coupled receptor signal transduction. Several alternatively spliced variants of this gene have been determined, all of which encode the same protein; additional variants may exist but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "NCALD"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


NCALD mouse monoclonal antibody,clone OTI6H3
    • 100 ul

USD 379.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones