GABA B Receptor 1(GABBR1) (NM_001470) Human Tagged ORF Clone

CAT#: RC214114

GABBR1 (Myc-DDK-tagged)-Human gamma-aminobutyric acid (GABA) B receptor, 1 (GABBR1), transcript variant 1

Change vector?

  • TrueORF®

USD 1,463


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GABA B Receptor 1(GABBR1) (NM_001470) Human Tagged ORF Clone
Symbol GABBR1
Synonyms GABABR1; GABBR1-3; GB1; GPRC3A
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214114 representing NM_001470
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCTGCTGCTGCTACTGGCGCCACTCTTCCTCCGCCCCCCGGGCGCGGGCGGGGCGCAGACCCCCA
ACGCCACCTCAGAAGGTTGCCAGATCATACACCCGCCCTGGGAAGGGGGCATCAGGTACCGGGGCCTGAC
TCGGGACCAGGTGAAGGCTATCAACTTCCTGCCAGTGGACTATGAGATTGAGTATGTGTGCCGGGGGGAG
CGCGAGGTGGTGGGGCCCAAGGTCCGCAAGTGCCTGGCCAACGGCTCCTGGACAGATATGGACACACCCA
GCCGCTGTGTCCGAATCTGCTCCAAGTCTTATTTGACCCTGGAAAATGGGAAGGTTTTCCTGACGGGTGG
GGACCTCCCAGCTCTGGACGGAGCCCGGGTGGATTTCCGGTGTGACCCCGACTTCCATCTGGTGGGCAGC
TCCCGGAGCATCTGTAGTCAGGGCCAGTGGAGCACCCCCAAGCCCCACTGCCAGGTGAATCGAACGCCAC
ACTCAGAACGGCGCGCAGTGTACATCGGGGCACTGTTTCCCATGAGCGGGGGCTGGCCAGGGGGCCAGGC
CTGCCAGCCCGCGGTGGAGATGGCGCTGGAGGACGTGAATAGCCGCAGGGACATCCTGCCGGACTATGAG
CTCAAGCTCATCCACCACGACAGCAAGTGTGATCCAGGCCAAGCCACCAAGTACCTATATGAGCTGCTCT
ACAACGACCCTATCAAGATCATCCTTATGCCTGGCTGCAGCTCTGTCTCCACGCTGGTGGCTGAGGCTGC
TAGGATGTGGAACCTCATTGTGCTTTCCTATGGCTCCAGCTCACCAGCCCTGTCAAACCGGCAGCGTTTC
CCCACTTTCTTCCGAACGCACCCATCAGCCACACTCCACAACCCTACCCGCGTGAAACTCTTTGAAAAGT
GGGGCTGGAAGAAGATTGCTACCATCCAGCAGACCACTGAGGTCTTCACTTCGACTCTGGACGACCTGGA
GGAACGAGTGAAGGAGGCTGGAATTGAGATTACTTTCCGCCAGAGTTTCTTCTCAGATCCAGCTGTGCCC
GTCAAAAACCTGAAGCGCCAGGATGCCCGAATCATCGTGGGACTTTTCTATGAGACTGAAGCCCGGAAAG
TTTTTTGTGAGGTGTACAAGGAGCGTCTCTTTGGGAAGAAGTACGTCTGGTTCCTCATTGGGTGGTATGC
TGACAATTGGTTCAAGATCTACGACCCTTCTATCAACTGCACAGTGGATGAGATGACTGAGGCGGTGGAG
GGCCACATCACAACTGAGATTGTCATGCTGAATCCTGCCAATACCCGCAGCATTTCCAACATGACATCCC
AGGAATTTGTGGAGAAACTAACCAAGCGACTGAAAAGACACCCTGAGGAGACAGGAGGCTTCCAGGAGGC
ACCGCTGGCCTATGATGCCATCTGGGCCTTGGCACTGGCCCTGAACAAGACATCTGGAGGAGGCGGCCGT
TCTGGTGTGCGCCTGGAGGACTTCAACTACAACAACCAGACCATTACCGACCAAATCTACCGGGCAATGA
ACTCTTCGTCCTTTGAGGGTGTCTCTGGCCATGTGGTGTTTGATGCCAGCGGCTCTCGGATGGCATGGAC
GCTTATCGAGCAGCTTCAGGGTGGCAGCTACAAGAAGATTGGCTACTATGACAGCACCAAGGATGATCTT
TCCTGGTCCAAAACAGATAAATGGATTGGAGGGTCCCCCCCAGCTGACCAGACCCTGGTCATCAAGACAT
TCCGCTTCCTGTCACAGAAACTCTTTATCTCCGTCTCAGTTCTCTCCAGCCTGGGCATTGTCCTAGCTGT
TGTCTGTCTGTCCTTTAACATCTACAACTCACATGTCCGTTATATCCAGAACTCACAGCCCAACCTGAAC
AACCTGACTGCTGTGGGCTGCTCACTGGCTTTAGCTGCTGTCTTCCCCCTGGGGCTCGATGGTTACCACA
TTGGGAGGAACCAGTTTCCTTTCGTCTGCCAGGCCCGCCTCTGGCTCCTGGGCCTGGGCTTTAGTCTGGG
CTACGGTTCCATGTTCACCAAGATTTGGTGGGTCCACACGGTCTTCACAAAGAAGGAAGAAAAGAAGGAG
TGGAGGAAGACTCTGGAACCCTGGAAGCTGTATGCCACAGTGGGCCTGCTGGTGGGCATGGATGTCCTCA
CTCTCGCCATCTGGCAGATCGTGGACCCTCTGCACCGGACCATTGAGACATTTGCCAAGGAGGAACCTAA
GGAAGATATTGACGTCTCTATTCTGCCCCAGCTGGAGCATTGCAGCTCCAGGAAGATGAATACATGGCTT
GGCATTTTCTATGGTTACAAGGGGCTGCTGCTGCTGCTGGGAATCTTCCTTGCTTATGAGACCAAGAGTG
TGTCCACTGAGAAGATCAATGATCACCGGGCTGTGGGCATGGCTATCTACAATGTGGCAGTCCTGTGCCT
CATCACTGCTCCTGTCACCATGATTCTGTCCAGCCAGCAGGATGCAGCCTTTGCCTTTGCCTCTCTTGCC
ATAGTTTTCTCCTCCTATATCACTCTTGTTGTGCTCTTTGTGCCCAAGATGCGCAGGCTGATCACCCGAG
GGGAATGGCAGTCGGAGGCGCAGGACACCATGAAGACAGGGTCATCGACCAACAACAACGAGGAGGAGAA
GTCCCGGCTGTTGGAGAAGGAGAACCGTGAACTGGAAAAGATCATTGCTGAGAAAGAGGAGCGTGTCTCT
GAACTGCGCCATCAACTCCAGTCTCGGCAGCAGCTCCGCTCCCGGCGCCACCCACCGACACCCCCAGAAC
CCTCTGGGGGCCTGCCCAGGGGACCCCCTGAGCCCCCCGACCGGCTTAGCTGTGATGGGAGTCGAGTGCA
TTTGCTTTATAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214114 representing NM_001470
Red=Cloning site Green=Tags(s)

MLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPVDYEIEYVCRGE
REVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDLPALDGARVDFRCDPDFHLVGS
SRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYE
LKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRF
PTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVP
VKNLKRQDARIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVE
GHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGR
SGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDL
SWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLN
NLTAVGCSLALAAVFPLGLDGYHIGRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKE
WRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWL
GIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLA
IVFSSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVS
ELRHQLQSRQQLRSRRHPPTPPEPSGGLPRGPPEPPDRLSCDGSRVHLLYK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001470
ORF Size 2883 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001470.1, NM_001470.2, NM_001470.3, NP_001461
RefSeq Size 4547
RefSeq ORF 2886
Locus ID 2550
Cytogenetics 6p22.1
Domains 7tm_3, CCP, ANF_receptor
Protein Families GPCR, Secreted Protein, Transmembrane, Druggable Genome
Protein Pathways Neuroactive ligand-receptor interaction
MW 108.8 kDa
Gene Summary This gene encodes a receptor for gamma-aminobutyric acid (GABA), which is the main inhibitory neurotransmitter in the mammalian central nervous system. This receptor functions as a heterodimer with GABA(B) receptor 2. Defects in this gene may underlie brain disorders such as schizophrenia and epilepsy. Alternative splicing generates multiple transcript variants, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Jan 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations