p19 INK4d (CDKN2D) (NM_001800) Human Tagged ORF Clone

CAT#: RC214065

Reviews ()
Write a review

CDKN2D (Myc-DDK-tagged)-Human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1



  "NM_001800" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CDKN2D
Synonyms INK4D; p19; p19-INK4D
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214065 representing NM_001800
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGCTGGAGGAGGTTCGCGCCGGCGACCGGCTGAGTGGGGCGGCGGCCCGGGGCGACGTGCAGGAGG
TGCGCCGCCTTCTGCACCGCGAGCTGGTGCATCCCGACGCCCTCAACCGCTTCGGCAAGACGGCGCTGCA
GGTCATGATGTTTGGCAGCACCGCCATCGCCCTGGAGCTGCTGAAGCAAGGTGCCAGCCCCAATGTCCAG
GACACCTCCGGTACCAGTCCAGTCCATGACGCAGCCCGCACTGGATTCCTGGACACCCTGAAGGTCCTAG
TGGAGCACGGGGCTGATGTCAACGTGCCTGATGGCACCGGGGCACTTCCAATCCATCTGGCAGTTCAAGA
GGGTCACACTGCTGTGGTCAGCTTTCTGGCAGCTGAATCTGATCTCCATCGCAGGGACGCCAGGGGTCTC
ACACCCTTGGAGCTGGCACTGCAGAGAGGGGCTCAGGACCTCGTGGACATCCTGCAGGGCCACATGGTGG
CCCCGCTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214065 representing NM_001800
Red=Cloning site Green=Tags(s)

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ
DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL
TPLELALQRGAQDLVDILQGHMVAPL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001800
ORF Size 498 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001800.3, NP_001791.1
RefSeq Size 1416 bp
RefSeq ORF 501 bp
Locus ID 1032
UniProt ID P55273
Cytogenetics 19p13.2
Protein Families Druggable Genome
Protein Pathways Cell cycle
MW 17.5 kDa
Gene Summary The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "CDKN2D"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


Rabbit polyclonal anti-P19 INK4d antibody
    • 100 ul

USD 380.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.