PRDM16 (NM_022114) Human Tagged ORF Clone

CAT#: RC214026

Reviews ()
Write a review

PRDM16 (Myc-DDK-tagged)-Human PR domain containing 16 (PRDM16), transcript variant 1



Reconstitution Protocol

USD 1,111.00

In Stock*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "PRDM16"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PRDM16
Synonyms CMD1LL; KMT8F; LVNC8; MEL1; PFM13
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC214026 representing NM_022114
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGATCCAAGGCGAGGGCGAGGAAGCTAGCCAAAAGTGACGGTGACGTTGTAAATAATATGTATGAGC
CCAACCGGGACCTGCTGGCCAGCCACAGCGCGGAGGACGAGGCCGAGGACAGTGCCATGTCGCCCATCCC
CGTGGGGCCACCGTCCCCCTTCCCCACCAGCGAGGACTTCACCCCCAAGGAGGGCTCGCCGTACGAGGCC
CCTGTCTACATTCCTGAAGACATTCCGATCCCAGCAGACTTCGAGCTCCGAGAGTCCTCCATCCCAGGGG
CTGGCCTGGGGGTCTGGGCCAAGAGGAAGATGGAAGCCGGGGAGAGGCTGGGCCCCTGCGTGGTGGTGCC
CCGGGCGGCGGCAAAGGAGACAGACTTCGGATGGGAGCAAATACTGACGGACGTGGAAGTGTCGCCCCAG
GAAGGCTGCATCACAAAGATCTCCGAAGACCTGGGCAGTGAGAAGTTCTGCGTGGATGCAAATCAGGCGG
GGGCTGGCAGCTGGCTCAAGTACATCCGTGTGGCGTGCTCCTGCGATGACCAGAACCTCACCATGTGTCA
GATCAGTGAGCAGATTTACTATAAAGTCATTAAGGACATTGAGCCAGGTGAGGAGCTGCTGGTGCACGTG
AAGGAAGGCGTCTACCCCCTGGGCACAGTGCCGCCCGGCCTGGACGAGGAGCCCACGTTCCGCTGTGACG
AGTGTGACGAACTCTTCCAGTCCAAGCTGGACCTGCGGCGCCATAAGAAGTACACGTGTGGCTCAGTGGG
GGCTGCGCTCTACGAGGGCCTGGCTGAGGAGCTCAAGCCCGAGGGCCTTGGCGGTGGCAGCGGCCAAGCC
CACGAGTGCAAGGACTGCGAGCGGATGTTCCCCAACAAGTACAGCCTGGAGCAGCACATGGTCATCCACA
CGGAGGAGCGCGAGTACAAATGCGACCAGTGTCCCAAGGCCTTCAACTGGAAGTCCAACCTCATCCGCCA
CCAGATGTCCCACGACAGCGGCAAACGCTTCGAATGTGAAAACTGCGTGAAGGTGTTCACGGACCCCAGC
AACCTTCAGCGGCACATCCGCTCGCAGCACGTGGGCGCTCGGGCCCACGCCTGCCCCGACTGCGGGAAGA
CCTTCGCCACGTCCTCCGGCCTCAAGCAGCACAAGCATATCCACAGCACGGTGAAGCCTTTCATATGTGA
GGTCTGCCACAAGTCCTACACGCAGTTCTCCAACCTGTGCCGGCACAAGCGGATGCACGCCGACTGCCGC
ACGCAGATCAAGTGCAAGGACTGTGGCCAGATGTTCAGCACTACCTCCTCCCTCAACAAGCACCGGCGCT
TCTGCGAGGGCAAGAACCATTACACGCCGGGCGGCATCTTTGCCCCGGGCCTGCCCTTGACCCCCAGCCC
CATGATGGACAAGGCAAAACCCTCCCCCAGCCTCAATCACGCCAGCCTGGGCTTCAACGAGTACTTTCCC
TCCAGGCCGCACCCGGGGAGCCTGCCCTTCTCCACGGCGCCTCCCACGTTCCCCGCACTCACCCCCGGCT
TCCCGGGCATCTTCCCTCCATCCTTGTACCCCCGGCCGCCTCTGCTACCTCCCACATCGCTGCTCAAGAG
CCCCCTGAACCACACCCAGGACGCCAAGCTCCCCAGTCCCCTGGGGAACCCAGCCCTGCCCCTGGTCTCC
GCCGTCAGCAACAGCAGCCAGGGCACGACGGCAGCTGCGGGGCCCGAGGAGAAGTTCGAGAGCCGCCTGG
AGGACTCCTGTGTGGAGAAGCTGAAGACCAGGAGCAGCGACATGTCGGACGGCAGTGACTTTGAGGACGT
CAACACCACCACGGGGACCGACCTGGACACGACCACGGGGACGGGCTCGGACCTGGACAGCGACGTGGAC
AGCGACCCTGACAAGGACAAGGGCAAGGGCAAGTCCGCCGAGGGCCAGCCCAAGTTTGGGGGCGGCTTGG
CGCCCCCGGGGGCCCCGAACAGCGTGGCCGAGGTGCCTGTCTTCTATTCCCAGCACTCATTCTTCCCGCC
ACCCGACGAGCAGCTGCTGACTGCAACGGGCGCCGCCGGGGACTCCATCAAGGCCATCGCATCCATTGCC
GAGAAGTACTTTGGCCCCGGCTTCATGGGGATGCAGGAGAAGAAGCTGGGCTCGCTCCCCTACCACTCGG
CGTTCCCCTTCCAGTTCCTGCCCAACTTCCCCCACTCCCTTTACCCCTTCACGGACCGAGCCCTCGCCCA
CAACTTGCTGGTCAAGGCCGAGCCAAAGTCACCCCGGGACGCCCTCAAGGTGGGCGGCCCCAGTGCCGAG
TGCCCCTTTGATCTCACCACCAAGCCCAAAGACGTGAAGCCCATCCTGCCCATGCCCAAGGGCCCCTCGG
CCCCCGCATCCGGCGAGGAGCAGCCGCTGGACCTGAGCATCGGCAGCCGGGCCCGTGCCAGCCAAAACGG
CGGCGGGCGGGAGCCCCGCAAGAACCACGTCTATGGGGAACGCAAGCTGGGCGCCGGCGAGGGGCTGCCC
CAGGTGTGCCCGGCGCGGATGCCCCAGCAGCCCCCGCTCCACTACGCCAAGCCCTCGCCCTTCTTCATGG
ACCCCATCTACAGCAGGGTAGAAAAGCGGAAGGTCACAGACCCCGTGGGAGCCCTGAAGGAGAAGTACCT
GCGGCCGTCCCCGCTGCTCTTCCACCCCCAGATGTCAGCCATAGAGACCATGACAGAGAAGCTGGAGAGC
TTTGCAGCCATGAAGGCGGACTCGGGCAGCTCCCTGCAGCCCCTCCCCCACCACCCCTTCAACTTCCGGT
CCCCACCCCCAACGCTCTCCGACCCCATCCTCAGGAAGGGCAAGGAGCGATACACGTGCAGGTACTGTGG
GAAGATCTTCCCCAGATCAGCCAATCTCACCAGACACCTGAGGACGCACACTGGGGAGCAGCCGTACAGG
TGTAAGTACTGCGACCGCTCCTTCAGCATCTCTTCGAACCTCCAGCGGCACGTCCGGAACATCCACAACA
AGGAGAAGCCTTTCAAGTGCCACCTGTGCAACCGCTGCTTCGGGCAGCAGACCAACCTGGACCGGCACCT
CAAGAAGCACGAGCACGAGAACGCACCAGTGAGCCAGCACCCCGGGGTCCTCACGAACCACCTGGGGACC
AGCGCGTCCTCTCCCACCTCAGAGTCGGACAACCACGCACTTTTAGACGAGAAAGAAGACTCTTATTTCT
CGGAAATCAGAAACTTTATTGCCAATAGTGAGATGAACCAAGCATCAACGCGAACAGAGAAACGGGCGGA
CATGCAGATCGTGGACGGCAGTGCCCAGTGTCCAGGCCTAGCCAGTGAGAAGCAGGAGGACGTGGAGGAG
GAGGACGACGATGACCTGGAGGAGGACGATGAGGACAGCCTGGCCGGGAAGTCGCAGGATGACACCGTGT
CCCCCGCACCCGAGCCCCAGGCCGCCTACGAGGATGAGGAGGATGAGGAGCCAGCCGCCTCCCTGGCCGT
GGGCTTTGACCACACCCGAAGGTGTGCTGAGGACCACGAAGGCGGTCTGTTAGCTTTGGAGCCGATGCCG
ACTTTTGGGAAGGGGCTGGACCTCCGCAGAGCAGCTGAGGAAGCATTTGAAGTTAAAGATGTGCTTAATT
CCACCTTAGATTCTGAGGCTTTAAAACATACACTGTGCAGGCAGGCTAAGAACCAGGCATATGCAATGAT
GCTGTCCCTTTCCGAAGACACTCCTCTCCACACCCCCTCCCAGGGTTCTCTGGACGCTTGGTTGAAGGTC
ACTGGAGCCACGTCGGAGTCTGGAGCATTTCACCCCATCAACCACCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC214026 representing NM_022114
Red=Cloning site Green=Tags(s)

MRSKARARKLAKSDGDVVNNMYEPNRDLLASHSAEDEAEDSAMSPIPVGPPSPFPTSEDFTPKEGSPYEA
PVYIPEDIPIPADFELRESSIPGAGLGVWAKRKMEAGERLGPCVVVPRAAAKETDFGWEQILTDVEVSPQ
EGCITKISEDLGSEKFCVDANQAGAGSWLKYIRVACSCDDQNLTMCQISEQIYYKVIKDIEPGEELLVHV
KEGVYPLGTVPPGLDEEPTFRCDECDELFQSKLDLRRHKKYTCGSVGAALYEGLAEELKPEGLGGGSGQA
HECKDCERMFPNKYSLEQHMVIHTEEREYKCDQCPKAFNWKSNLIRHQMSHDSGKRFECENCVKVFTDPS
NLQRHIRSQHVGARAHACPDCGKTFATSSGLKQHKHIHSTVKPFICEVCHKSYTQFSNLCRHKRMHADCR
TQIKCKDCGQMFSTTSSLNKHRRFCEGKNHYTPGGIFAPGLPLTPSPMMDKAKPSPSLNHASLGFNEYFP
SRPHPGSLPFSTAPPTFPALTPGFPGIFPPSLYPRPPLLPPTSLLKSPLNHTQDAKLPSPLGNPALPLVS
AVSNSSQGTTAAAGPEEKFESRLEDSCVEKLKTRSSDMSDGSDFEDVNTTTGTDLDTTTGTGSDLDSDVD
SDPDKDKGKGKSAEGQPKFGGGLAPPGAPNSVAEVPVFYSQHSFFPPPDEQLLTATGAAGDSIKAIASIA
EKYFGPGFMGMQEKKLGSLPYHSAFPFQFLPNFPHSLYPFTDRALAHNLLVKAEPKSPRDALKVGGPSAE
CPFDLTTKPKDVKPILPMPKGPSAPASGEEQPLDLSIGSRARASQNGGGREPRKNHVYGERKLGAGEGLP
QVCPARMPQQPPLHYAKPSPFFMDPIYSRVEKRKVTDPVGALKEKYLRPSPLLFHPQMSAIETMTEKLES
FAAMKADSGSSLQPLPHHPFNFRSPPPTLSDPILRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYR
CKYCDRSFSISSNLQRHVRNIHNKEKPFKCHLCNRCFGQQTNLDRHLKKHEHENAPVSQHPGVLTNHLGT
SASSPTSESDNHALLDEKEDSYFSEIRNFIANSEMNQASTRTEKRADMQIVDGSAQCPGLASEKQEDVEE
EDDDDLEEDDEDSLAGKSQDDTVSPAPEPQAAYEDEEDEEPAASLAVGFDHTRRCAEDHEGGLLALEPMP
TFGKGLDLRRAAEEAFEVKDVLNSTLDSEALKHTLCRQAKNQAYAMMLSLSEDTPLHTPSQGSLDAWLKV
TGATSESGAFHPINHL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_022114
ORF Size 3828 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_022114.4
RefSeq Size 8726 bp
RefSeq ORF 3831 bp
Locus ID 63976
UniProt ID Q9HAZ2
Cytogenetics 1p36.32
MW 140.1 kDa
Gene Summary The reciprocal translocation t(1;3)(p36;q21) occurs in a subset of myelodysplastic syndrome (MDS) and acute myeloid leukemia (AML). This gene is located near the 1p36.3 breakpoint and has been shown to be specifically expressed in the t(1:3)(p36,q21)-positive MDS/AML. The protein encoded by this gene is a zinc finger transcription factor and contains an N-terminal PR domain. The translocation results in the overexpression of a truncated version of this protein that lacks the PR domain, which may play an important role in the pathogenesis of MDS and AML. Alternatively spliced transcript variants encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.