DPP6 (NM_130797) Human Tagged ORF Clone

CAT#: RC214014

DPP6 (Myc-DDK-tagged)-Human dipeptidyl-peptidase 6 (DPP6), transcript variant 1

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,329.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DPP6 (NM_130797) Human Tagged ORF Clone
Symbol DPP6
Synonyms DPL1; DPPX; MRD33; VF2
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC214014 representing NM_130797
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTTCGCTGTACCAGAGGTTCACTGGCAAGATCAACACCTCGAGGTCCTTCCCCGCGCCCCCGGAGG
CGAGTCACCTCCTGGGCGGCCAGGGGCCCGAGGAGGACGGCGGCGCAGGAGCCAAGCCCCTCGGCCCGCG
GGCGCAGGCGGCGGCGCCCCGGGAGCGCGGCGGCGGCGGCGGCGGCGCGGGTGGCCGGCCCCGGTTCCAG
TACCAGGCGCGGAGCGATGGTGACGAGGAGGACGAGCTGGTGGGGAGTAACCCTCCGCAGAGGAATTGGA
AAGGAATAGCAATTGCACTGCTTGTCATTCTGGTCATCTGCTCCTTGATCGTCACCTCGGTCATACTTCT
GACACCAGCGGAAGATAATAGTCTGTCTCAAAAGAAGAAGGTCACTGTAGAAGATCTCTTCAGTGAAGAC
TTCAAAATTCATGACCCCGAGGCTAAGTGGATAAGTGATACAGAATTCATCTACAGAGAACAGAAAGGAA
CAGTGAGACTGTGGAATGTTGAAACAAATACTTCTACTGTCTTAATAGAAGGCAAAAAAATTGAATCATT
AAGAGCCATCAGATATGAAATATCTCCAGATAGAGAGTATGCACTTTTTTCATACAATGTGGAACCCATA
TATCAACACTCGTATACTGGATATTACGTCCTGAGCAAAATTCCTCATGGGGATCCTCAAAGTCTGGACC
CACCAGAAGTCAGCAATGCAAAACTTCAGTATGCAGGATGGGGCCCTAAAGGCCAACAGCTGATATTTAT
TTTTGAAAACAATATCTACTACTGTGCACATGTCGGGAAACAGGCCATCCGTGTGGTCTCCACTGGCAAG
GAAGGTGTGATTTACAATGGCCTCAGTGACTGGCTGTATGAAGAGGAGATTTTGAAGACACACATCGCAC
ACTGGTGGTCTCCGGATGGCACGAGACTCGCCTACGCCGCCATCAATGATTCCCGTGTCCCCATCATGGA
GCTCCCAACTTACACCGGCTCCATCTACCCCACCGTGAAGCCCTACCACTATCCCAAGGCTGGAAGTGAG
AACCCCAGCATTTCCCTACACGTTATTGGCTTAAATGGACCCACCCATGATCTGGAGATGATGCCGCCTG
ATGATCCACGGATGAGGGAGTACTACATCACCATGGTGAAGTGGGCCACCAGCACCAAGGTCGCCGTGAC
CTGGCTGAACCGGGCGCAGAACGTGTCCATCCTCACCCTCTGCGACGCCACCACGGGGGTCTGCACGAAG
AAACACGAGGATGAAAGTGAGGCCTGGCTCCACAGACAGAATGAAGAACCTGTGTTCTCCAAGGATGGCC
GAAAGTTTTTCTTCATCAGAGCCATCCCCCAGGGAGGACGAGGGAAATTCTATCACATCACGGTGTCCTC
GTCCCAGCCCAACAGCAGCAACGACAACATCCAGTCCATCACCTCCGGGGACTGGGACGTGACCAAGATC
CTAGCCTACGATGAGAAGGGGAATAAGATCTACTTCCTGAGCACGGAGGACCTGCCTCGGAGACGACAAC
TCTACAGTGCCAACACGGTGGGCAACTTCAACAGGCAGTGCCTCTCCTGTGACCTGGTTGAGAACTGCAC
CTACTTCAGCGCTTCCTTCAGCCATAGCATGGACTTCTTCCTGCTCAAGTGCGAAGGTCCTGGTGTTCCT
ATGGTGACGGTGCACAACACAACAGATAAGAAAAAAATGTTTGACCTAGAAACAAATGAACATGTCAAGA
AGGCCATAAATGACCGACAGATGCCTAAAGTGGAATACAGGGACATTGAGATTGATGATTACAACCTGCC
CATGCAGATACTGAAGCCAGCAACCTTCACCGACACCACCCACTACCCTCTGCTCCTGGTGGTGGATGGC
ACCCCGGGCAGCCAGAGTGTGGCTGAGAAGTTCGAGGTGAGCTGGGAGACGGTGATGGTGAGCAGCCACG
GCGCGGTGGTGGTAAAGTGTGACGGCCGTGGCAGCGGCTTCCAAGGGACCAAGCTCCTGCACGAAGTGAG
GCGGCGGCTGGGCTTGCTGGAGGAGAAGGACCAGATGGAGGCCGTGCGGACGATGCTGAAGGAGCAGTAC
ATTGACAGGACGCGCGTGGCCGTGTTTGGGAAGGATTACGGTGGCTACCTGAGCACCTACATCCTCCCAG
CAAAGGGAGAAAATCAAGGCCAGACATTCACCTGCGGCTCTGCTCTCTCTCCAATAACAGACTTCAAACT
CTATGCCTCTGCGTTTTCCGAGAGGTACTTGGGCCTCCATGGACTTGACAACAGAGCATACGAGATGACC
AAGGTAGCCCATCGAGTCTCCGCGCTGGAAGAACAGCAGTTCCTGATCATTCATCCCACTGCCGATGAAA
AAATTCATTTCCAGCACACAGCAGAACTCATTACACAACTAATTAGGGGAAAGGCTAATTACAGCTTACA
GATTTACCCGGACGAAAGCCATTACTTTACCAGCTCCAGCCTCAAACAGCATCTGTACCGGTCCATCATC
AACTTCTTCGTGGAATGCTTCAGGATCCAGGACAAACTGCCGACAGTCACAGCGAAAGAGGACGAGGAGG
AGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC214014 representing NM_130797
Red=Cloning site Green=Tags(s)

MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ
YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED
FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI
YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK
EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE
NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI
LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP
MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG
TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY
IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT
KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII
NFFVECFRIQDKLPTVTAKEDEEED

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_130797
ORF Size 2595 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_130797.1, NM_130797.2, NM_130797.3, NP_570629
RefSeq Size 3712
RefSeq ORF 2598
Locus ID 1804
Cytogenetics 7q36.2
Domains Peptidase_S9, DPPIV_N_term
Protein Families Transmembrane, Protease, Druggable Genome
MW 97.4 kDa
Gene Summary This gene encodes a single-pass type II membrane protein that is a member of the peptidase S9B family of serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Variations in this gene may be associated with susceptibility to amyotrophic lateral sclerosis and with idiopathic ventricular fibrillation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)