ABCA5 (NM_018672) Human Tagged ORF Clone

CAT#: RC213865

Reviews ()
Write a review
  • TrueORF®

ABCA5 (Myc-DDK-tagged)-Human ATP-binding cassette, sub-family A (ABC1), member 5 (ABCA5), transcript variant 1



  "NM_018672" in other vectors (4)

USD 1,720.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ABCA5 (NM_018672) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol ABCA5
Synonyms ABC13; EST90625; HTC3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213865 representing NM_018672
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACTGCAATTAGGGAGGTAGGAGTTTGGAGACAGACCAGAACACTTCTACTGAAGAATTACTTAA
TTAAATGCAGAACCAAAAAGAGTAGTGTTCAGGAAATTCTTTTTCCACTATTTTTTTTATTTTGGTTAAT
ATTAATTAGCATGATGCATCCAAATAAGAAATATGAAGAAGTGCCTAATATAGAACTCAATCCTATGGAC
AAGTTTACTCTTTCTAATCTAATTCTTGGATATACTCCAGTGACTAATATTACAAGCAGCATCATGCAGA
AAGTGTCTACTGATCATCTACCTGATGTCATAATTACTGAAGAATATACAAATGAAAAAGAAATGTTAAC
ATCCAGTCTCTCTAAGCCGAGCAACTTTGTAGGTGTGGTTTTCAAAGACTCCATGTCCTATGAACTTCGT
TTTTTTCCTGATATGATTCCAGTATCTTCTATTTATATGGATTCAAGAGCTGGCTGTTCAAAATCATGTG
AGGCTGCTCAGTACTGGTCCTCAGGTTTCACAGTTTTACAAGCATCCATAGATGCTGCCATTATACAGTT
GAAGACCAATGTTTCTCTTTGGAAGGAGCTGGAGTCAACTAAAGCTGTTATTATGGGAGAAACTGCTGTT
GTAGAAATAGATACCTTTCCCCGAGGAGTAATTTTAATATACCTAGTTATAGCATTTTCACCTTTTGGAT
ACTTTTTGGCAATTCATATCGTAGCAGAAAAAGAAAAAAAAATAAAAGAATTTTTAAAGATAATGGGACT
TCATGATACTGCCTTTTGGCTTTCCTGGGTTCTTCTATATACAAGTTTAATTTTTCTTATGTCCCTTCTT
ATGGCAGTCATTGCGACAGCTTCTTTGTTATTTCCTCAAAGTAGCAGCATTGTGATATTTCTGCTTTTTT
TCCTTTATGGATTATCATCTGTATTTTTTGCTTTAATGCTGACACCTCTTTTTAAAAAATCAAAACATGT
GGGAATAGTTGAATTTTTTGTTACTGTGGCTTTTGGATTTATTGGCCTTATGATAATCCTCATAGAAAGT
TTTCCCAAATCGTTAGTGTGGCTTTTCAGTCCTTTCTGTCACTGTACTTTTGTGATTGGTATTGCACAGG
TCATGCATTTAGAAGATTTTAATGAAGGTGCTTCATTTTCAAATTTGACTGCAGGCCCATATCCTCTAAT
TATTACAATTATCATGCTCACACTTAATAGTATATTCTATGTCCTCTTGGCTGTCTATCTTGATCAAGTC
ATTCCAGGGGAATTTGGCTTACGGAGATCATCTTTATATTTTCTGAAGCCTTCATATTGGTCAAAGAGCA
AAAGAAATTATGAGGAGTTATCAGAGGGCAATGTTAATGGAAATATTAGTTTTAGTGAAATTATTGAGCC
AGTTTCTTCAGAATTTGTAGGAAAAGAAGCCATAAGAATTAGTGGTATTCAGAAGACATACAGAAAGAAG
GGTGAAAATGTGGAGGCTTTGAGAAATTTGTCATTTGACATATATGAGGGTCAGATTACTGCCTTACTTG
GCCACAGTGGAACAGGAAAGAGTACATTGATGAATATTCTTTGTGGACTCTGCCCACCTTCTGATGGGTT
TGCATCTATATATGGACACAGAGTCTCAGAAATAGATGAAATGTTTGAAGCAAGAAAAATGATTGGCATT
TGTCCACAGTTAGATATACACTTTGATGTTTTGACAGTAGAAGAAAATTTATCAATTTTGGCTTCAATCA
AAGGGATACCAGCCAACAATATAATACAAGAAGTGCAGAAGGTTTTACTAGATTTAGACATGCAGACTAT
CAAAGATAACCAAGCTAAAAAATTAAGTGGTGGTCAAAAAAGAAAGCTGTCATTAGGAATTGCTGTTCTT
GGGAACCCAAAGATACTGCTGCTAGATGAACCAACAGCTGGAATGGACCCCTGTTCTCGACATATTGTAT
GGAATCTTTTAAAATACAGAAAAGCCAATCGGGTGACAGTGTTCAGTACTCATTTCATGGATGAAGCTGA
CATTCTTGCAGATAGGAAAGCTGTGATATCACAAGGAATGCTGAAATGTGTTGGTTCTTCAATGTTCCTC
AAAAGTAAATGGGGGATCGGCTACCGCCTGAGCATGTACATAGACAAATATTGTGCCACAGAATCTCTTT
CTTCACTGGTTAAACAACATATACCTGGAGCTACTTTATTACAACAGAATGACCAACAACTTGTGTATAG
CTTGCCTTTCAAGGACATGGACAAATTTTCAGGTTTGTTTTCTGCCCTAGACAGTCATTCAAATTTGGGT
GTCATTTCTTATGGTGTTTCCATGACGACTTTGGAAGACGTATTTTTAAAGCTAGAAGTTGAAGCAGAAA
TTGACCAAGCAGATTATAGTGTATTTACTCAGCAGCCACTGGAGGAAGAAATGGATTCAAAATCTTTTGA
TGAAATGGAACAGAGCTTACTTATTCTTTCTGAAACCAAGGCTGCTCTAGTGAGCACCATGAGCCTTTGG
AAACAACAGATGTATACAATAGCAAAGTTTCATTTCTTTACCTTGAAACGTGAAAGTAAATCAGTGAGAT
CAGTGTTGCTTCTGCTTTTAATTTTTTTCACAGTTCAGATTTTTATGTTTTTGGTTCATCACTCTTTTAA
AAATGCTGTGGTTCCCATCAAACTTGTTCCAGACTTATATTTTCTAAAACCTGGAGACAAACCACATAAA
TACAAAACAAGTCTGCTTCTTCAAAATTCTGCTGACTCAGATATCAGTGATCTTATTAGCTTTTTCACAA
GCCAGAACATAATGGTGACGATGATTAATGACAGTGACTATGTATCCGTGGCTCCCCATAGTGCGGCTTT
AAATGTGATGCATTCAGAAAAGGACTATGTTTTTGCAGCTGTTTTCAACAGTACTATGGTTTATTCTTTA
CCTATATTAGTGAATATCATTAGTAACTACTATCTTTATCATTTAAATGTGACTGAAACCATCCAGATCT
GGAGTACCCCATTCTTTCAAGAAATTACTGATATAGTTTTTAAAATTGAGCTGTATTTTCAAGCAGCTTT
GCTTGGAATCATTGTTACTGCAATGCCACCTTACTTTGCCATGGAAAATGCAGAGAATCATAAGATCAAA
GCTTATACTCAACTTAAACTTTCAGGTCTTTTGCCATCTGCATATTGGATTGGACAAGCTGTTGTTGATA
TCCCCTTATTTTTTATCATTCTTATTTTGATGCTAGGAAGCTTATTGGCATTTCATTATGGATTATATTT
TTATACTGTAAAGTTCCTTGCTGTGGTTTTTTGCCTTATTGGTTATGTTCCATCAGTTATTCTGTTCACT
TATATTGCTTCTTTCACCTTTAAGAAAATTTTAAATACCAAAGAATTTTGGTCATTTATCTATTCTGTGG
CAGCGTTGGCTTGTATTGCAATCACTGAAATAACTTTCTTTATGGGATACACAATTGCAACTATTCTTCA
TTATGCCTTTTGTATCATCATTCCAATCTATCCACTTCTAGGTTGCCTGATTTCTTTCATAAAGATTTCT
TGGAAGAATGTACGAAAAAATGTGGACACCTATAATCCATGGGATAGGCTTTCAGTAGCTGTTATATCGC
CTTACCTGCAGTGTGTACTGTGGATTTTCCTCTTACAATACTATGAGAAAAAATATGGAGGCAGATCAAT
AAGAAAAGATCCCTTTTTCAGAAACCTTTCAACGAAGTCTAAAAATAGGAAGCTTCCAGAACCACCAGAC
AATGAGGATGAAGATGAAGATGTCAAAGCTGAAAGACTAAAGGTCAAAGAGCTGATGGGTTGCCAGTGTT
GTGAGGAGAAACCATCCATTATGGTCAGCAATTTGCATAAAGAATATGATGACAAGAAAGATTTTCTTCT
TTCAAGAAAAGTAAAGAAAGTGGCAACTAAATACATCTCTTTCTGTGTGAAAAAAGGAGAGATCTTAGGA
CTATTGGGTCCAAATGGTGCTGGCAAAAGCACAATTATTAATATTCTGGTTGGTGATATTGAACCAACTT
CAGGCCAGGTATTTTTAGGAGATTATTCTTCAGAGACAAGTGAAGATGATGATTCACTGAAGTGTATGGG
TTACTGTCCTCAGATAAACCCTTTGTGGCCAGATACTACATTGCAGGAACATTTTGAAATTTATGGAGCT
GTCAAAGGAATGAGTGCAAGTGACATGAAAGAAGTCATAAGTCGAATAACACATGCACTTGATTTAAAAG
AACATCTTCAGAAGACTGTAAAGAAACTACCTGCAGGAATCAAACGAAAGTTGTGTTTTGCTCTAAGTAT
GCTAGGGAATCCTCAGATTACTTTGCTAGATGAACCATCTACAGGTATGGATCCCAAAGCCAAACAGCAC
ATGTGGCGAGCAATTCGAACTGCATTTAAAAACAGAAAGCGGGCTGCTATTCTGACCACTCACTATATGG
AGGAGGCAGAGGCTGTCTGTGATCGAGTAGCTATCATGGTGTCTGGGCAGTTAAGATGTATCGGAACAGT
ACAACATCTAAAGAGTAAATTTGGAAAAGGCTACTTTTTGGAAATTAAATTGAAGGACTGGATAGAAAAC
CTAGAAGTAGACCGCCTTCAAAGAGAAATTCAGTATATTTTCCCAAATGCAAGCCGTCAGGAAAGTTTTT
CTTCTATTTTGGCTTATAAAATTCCTAAGGAAGATGTTCAGTCCCTTTCACAATCTTTTTTTAAGCTGGA
AGAAGCTAAACATGCTTTTGCCATTGAAGAATATAGCTTTTCTCAAGCAACATTGGAACAGGTTTTTGTA
GAACTCACTAAAGAACAAGAGGAGGAAGATAATAGTTGTGGAACTTTAAACAGCACACTTTGGTGGGAAC
GAACACAAGAAGATAGAGTAGTATTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213865 representing NM_018672
Red=Cloning site Green=Tags(s)

MSTAIREVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILISMMHPNKKYEEVPNIELNPMD
KFTLSNLILGYTPVTNITSSIMQKVSTDHLPDVIITEEYTNEKEMLTSSLSKPSNFVGVVFKDSMSYELR
FFPDMIPVSSIYMDSRAGCSKSCEAAQYWSSGFTVLQASIDAAIIQLKTNVSLWKELESTKAVIMGETAV
VEIDTFPRGVILIYLVIAFSPFGYFLAIHIVAEKEKKIKEFLKIMGLHDTAFWLSWVLLYTSLIFLMSLL
MAVIATASLLFPQSSSIVIFLLFFLYGLSSVFFALMLTPLFKKSKHVGIVEFFVTVAFGFIGLMIILIES
FPKSLVWLFSPFCHCTFVIGIAQVMHLEDFNEGASFSNLTAGPYPLIITIIMLTLNSIFYVLLAVYLDQV
IPGEFGLRRSSLYFLKPSYWSKSKRNYEELSEGNVNGNISFSEIIEPVSSEFVGKEAIRISGIQKTYRKK
GENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASIYGHRVSEIDEMFEARKMIGI
CPQLDIHFDVLTVEENLSILASIKGIPANNIIQEVQKVLLDLDMQTIKDNQAKKLSGGQKRKLSLGIAVL
GNPKILLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSMFL
KSKWGIGYRLSMYIDKYCATESLSSLVKQHIPGATLLQQNDQQLVYSLPFKDMDKFSGLFSALDSHSNLG
VISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPLEEEMDSKSFDEMEQSLLILSETKAALVSTMSLW
KQQMYTIAKFHFFTLKRESKSVRSVLLLLLIFFTVQIFMFLVHHSFKNAVVPIKLVPDLYFLKPGDKPHK
YKTSLLLQNSADSDISDLISFFTSQNIMVTMINDSDYVSVAPHSAALNVMHSEKDYVFAAVFNSTMVYSL
PILVNIISNYYLYHLNVTETIQIWSTPFFQEITDIVFKIELYFQAALLGIIVTAMPPYFAMENAENHKIK
AYTQLKLSGLLPSAYWIGQAVVDIPLFFIILILMLGSLLAFHYGLYFYTVKFLAVVFCLIGYVPSVILFT
YIASFTFKKILNTKEFWSFIYSVAALACIAITEITFFMGYTIATILHYAFCIIIPIYPLLGCLISFIKIS
WKNVRKNVDTYNPWDRLSVAVISPYLQCVLWIFLLQYYEKKYGGRSIRKDPFFRNLSTKSKNRKLPEPPD
NEDEDEDVKAERLKVKELMGCQCCEEKPSIMVSNLHKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILG
LLGPNGAGKSTIINILVGDIEPTSGQVFLGDYSSETSEDDDSLKCMGYCPQINPLWPDTTLQEHFEIYGA
VKGMSASDMKEVISRITHALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQITLLDEPSTGMDPKAKQH
MWRAIRTAFKNRKRAAILTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIEN
LEVDRLQREIQYIFPNASRQESFSSILAYKIPKEDVQSLSQSFFKLEEAKHAFAIEEYSFSQATLEQVFV
ELTKEQEEEDNSCGTLNSTLWWERTQEDRVVF

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018672
ORF Size 4926 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018672.1, NM_018672.2, NM_018672.3, NM_018672.4, NP_061142.2
RefSeq Size 7044 bp
RefSeq ORF 4929 bp
Locus ID 23461
Cytogenetics 17q24.3
Domains ABC_tran, AAA
Protein Families Druggable Genome, Transmembrane
Protein Pathways ABC transporters
MW 186.3 kDa
Gene Summary The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [provided by RefSeq, Jul 2008]

Citations (1)

Other Versions

Other products for "ABCA5"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-ABCA5 Antibody
    • 100 ul

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools