PICALM (NM_007166) Human Tagged ORF Clone

CAT#: RC213791

Reviews ()
Write a review

PICALM (Myc-DDK-tagged)-Human phosphatidylinositol binding clathrin assembly protein (PICALM), transcript variant 1



  "NM_007166" in other vectors (6)

Special Offer: 20% off on control vector. Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PICALM
Synonyms CALM; CLTH; LAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213791 representing NM_007166
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCGGCCAGAGCCTGACGGACCGAATCACTGCCGCCCAGCACAGTGTCACCGGCTCTGCCGTATCCA
AGACAGTATGCAAGGCCACGACCCACGAGATCATGGGGCCCAAGAAAAAGCACCTGGACTACTTAATTCA
GTGCACAAATGAGATGAATGTGAACATCCCACAGTTGGCAGACAGTTTATTTGAAAGAACTACTAATAGT
AGTTGGGTGGTGGTCTTCAAATCTCTCATTACAACTCATCATTTGATGGTGTATGGAAATGAGCGTTTTA
TTCAGTATTTGGCTTCAAGAAACACGTTGTTTAACTTAAGCAATTTTTTGGATAAAAGTGGATTGCAAGG
ATATGACATGTCTACATTTATTAGGCGGTATAGTAGATATTTAAATGAGAAAGCAGTTTCATACAGACAA
GTTGCATTTGATTTCACAAAAGTGAAGAGAGGGGCTGATGGAGTTATGAGAACAATGAACACAGAAAAAC
TCCTAAAAACTGTACCAATTATTCAGAATCAGATGGATGCACTTCTTGATTTTAATGTTAATAGCAATGA
ACTTACAAATGGGGTAATAAATGCTGCCTTCATGCTCCTGTTCAAAGATGCCATTAGACTGTTTGCAGCA
TACAATGAAGGAATTATTAATTTGTTGGAAAAATATTTTGATATGAAAAAGAACCAATGCAAAGAAGGTC
TTGACATCTATAAGAAGTTCCTAACTAGGATGACAAGAATCTCAGAGTTCCTCAAAGTTGCAGAGCAAGT
TGGAATTGACAGAGGTGATATACCAGACCTTTCACAGGCCCCTAGCAGTCTTCTTGATGCTTTGGAACAA
CATTTAGCTTCCTTGGAAGGAAAGAAAATCAAAGATTCTACAGCTGCAAGCAGGGCAACTACACTTTCCA
ATGCAGTGTCTTCCCTGGCAAGCACTGGTCTATCTCTGACCAAAGTGGATGAAAGGGAAAAGCAGGCAGC
ATTAGAGGAAGAACAGGCACGTTTGAAAGCTTTAAAGGAACAGCGCCTAAAAGAACTTGCAAAGAAACCT
CATACCTCTTTAACAACTGCAGCCTCTCCTGTATCCACCTCAGCAGGAGGGATAATGACTGCACCAGCCA
TTGACATATTTTCTACCCCTAGTTCTTCTAACAGCACATCAAAGCTGCCCAATGATCTGCTTGATTTGCA
GCAGCCAACTTTTCACCCATCTGTACATCCTATGTCAACTGCTTCTCAGGTAGCAAGTACATGGGGAGAT
CCTTTCTCTGCTACTGTAGATGCTGTTGATGATGCCATTCCAAGCTTAAATCCTTTCCTCACAAAAAGTA
GTGGTGATGTTCACCTTTCCATTTCTTCAGATGTATCTACTTTTACTACTAGGACACCTACTCATGAAAT
GTTTGTTGGATTCACTCCTTCTCCAGTTGCACAGCCACACCCTTCAGCTGGCCTTAATGTTGACTTTGAA
TCTGTGTTTGGAAATAAATCTACAAATGTTATTGTAGATTCTGGGGGCTTTGATGAACTAGGTGGACTTC
TCAAACCAACAGTGGCCTCTCAGAACCAGAACCTTCCTGTTGCCAAACTCCCACCTAGCAAGTTAGTATC
TGATGACTTGGATTCATCTTTAGCCAACCTTGTGGGCAATCTTGGCATCGGAAATGGAACCACTAAGAAT
GATGTAAATTGGAGTCAACCAGGTGAAAAGAAGTTAACTGGGGGATCTAACTGGCAACCAAAGGTTGCAC
CAACAACCGCTTGGAATGCTGCAACAATGGCACCCCCTGTAATGGCCTATCCTGCTACTACACCAACAGG
CATGATAGGATATGGAATTCCTCCACAAATGGGAAGTGTTCCTGTAATGACGCAACCAACCTTAATATAC
AGCCAGCCTGTCATGAGACCTCCAAACCCCTTTGGCCCTGTATCAGGAGCACAGATACAGTTTATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213791 representing NM_007166
Red=Cloning site Green=Tags(s)

MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLADSLFERTTNS
SWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDMSTFIRRYSRYLNEKAVSYRQ
VAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLDFNVNSNELTNGVINAAFMLLFKDAIRLFAA
YNEGIINLLEKYFDMKKNQCKEGLDIYKKFLTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQ
HLASLEGKKIKDSTAASRATTLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKP
HTSLTTAASPVSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPHPSAGLNVDFE
SVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDLDSSLANLVGNLGIGNGTTKN
DVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAYPATTPTGMIGYGIPPQMGSVPVMTQPTLIY
SQPVMRPPNPFGPVSGAQIQFM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007166
ORF Size 1956 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007166.4
RefSeq Size 3860 bp
RefSeq ORF 1959 bp
Locus ID 8301
UniProt ID Q13492
Cytogenetics 11q14.2
Domains ENTH
Protein Families Druggable Genome
MW 70.6 kDa
Gene Summary This gene encodes a clathrin assembly protein, which recruits clathrin and adaptor protein complex 2 (AP2) to cell membranes at sites of coated-pit formation and clathrin-vesicle assembly. The protein may be required to determine the amount of membrane to be recycled, possibly by regulating the size of the clathrin cage. The protein is involved in AP2-dependent clathrin-mediated endocytosis at the neuromuscular junction. A chromosomal translocation t(10;11)(p13;q14) leading to the fusion of this gene and the MLLT10 gene is found in acute lymphoblastic leukemia, acute myeloid leukemia and malignant lymphomas. The polymorphisms of this gene are associated with the risk of Alzheimer disease. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2011]

Other Versions

Other products for "PICALM"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


Rabbit Polyclonal PICALM Antibody
    • 100 ug

USD 484.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.