CILK1 (NM_014920) Human Tagged ORF Clone

CAT#: RC213609

Reviews ()
Write a review

ICK (Myc-DDK-tagged)-Human intestinal cell (MAK-like) kinase (ICK), transcript variant 1



  "NM_014920" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 588.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "CILK1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol CILK1
Synonyms ECO; EJM10; hICK; ICK; LCK2; MRK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213609 representing NM_014920
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAGATACACAACAATCAGGCAGCTCGGGGATGGAACCTACGGTTCCGTCCTGCTGGGAAGAAGCA
TTGAGTCTGGGGAGCTGATCGCTATTAAAAAAATGAAAAGAAAATTTTATTCCTGGGAGGAATGCATGAA
CCTTCGGGAGGTTAAGTCTTTAAAGAAGCTCAACCATGCCAATGTAGTCAAATTAAAAGAAGTTATCAGG
GAAAATGATCATCTTTATTTTATCTTCGAGTACATGAAGGAAAATCTTTACCAGCTCATTAAAGAGAGAA
ATAAGTTGTTTCCTGAGTCTGCTATAAGGAATATCATGTATCAGATATTACAAGGACTCGCATTTATTCA
CAAACACGGCTTCTTTCATCGAGACTTAAAGCCTGAGAACCTCCTCTGCATGGGACCAGAACTTGTGAAA
ATTGCAGACTTTGGTTTGGCCCGAGAAATACGATCAAAACCTCCATATACAGATTATGTATCTACCAGAT
GGTACAGGGCTCCAGAAGTACTCCTGAGGTCTACCAACTACAGCTCCCCCATTGACGTCTGGGCGGTGGG
CTGCATCATGGCAGAAGTTTACACCCTCAGGCCACTCTTCCCTGGAGCCAGTGAAATTGACACAATATTC
AAAATTTGCCAAGTGCTGGGGACACCAAAAAAGACTGACTGGCCTGAAGGCTATCAACTTTCAAGTGCAA
TGAACTTCCGTTGGCCACAGTGTGTACCCAATAACTTAAAGACCTTGATTCCCAATGCTAGCAGTGAAGC
AGTCCAGCTCCTGAGAGACATGCTTCAGTGGGATCCCAAGAAACGACCAACAGCTAGTCAGGCACTTCGA
TATCCTTACTTCCAAGTTGGACACCCACTAGGCAGCACCACACAAAACCTTCAGGATTCAGAAAAACCAC
AGAAAGGCATCCTGGAAAAGGCAGGCCCACCTCCTTATATTAAGCCAGTCCCACCTGCCCAGCCACCAGC
CAAGCCACACACACGAATTTCTTCACGACAGCATCAAGCCAGCCAGCCCCCTCTGCATCTCACGTACCCC
TACAAAGCAGAGGTCTCCAGGACAGATCACCCAAGCCATCTCCAGGAGGACAAGCCAAGCCCGTTGCTTT
TCCCATCCCTCCACAACAAGCATCCACAGTCGAAAATCACAGCTGGCCTGGAGCACAAAAATGGTGAGAT
AAAGCCAAAGAGTAGGAGAAGGTGGGGTCTTATTTCCAGGTCAACAAAGGATTCAGATGATTGGGCTGAC
TTGGATGACTTGGATTTCAGTCCATCCCTCAGCAGGATTGACCTGAAAAACAAGAAAAGACAGAGTGATG
ACACTCTCTGCAGGTTTGAGAGTGTTTTGGACCTGAAGCCCTCTGAGCCTGTGGGCACAGGAAACAGTGC
CCCCACCCAGACGTCATATCAGCGGCGAGACACGCCCACCCTGAGATCTGCAGCCAAGCAGCACTATTTG
AAGCACTCTCGATACTTGCCTGGGATCAGTATAAGAAATGGCATACTCTCGAATCCAGGCAAGGAATTTA
TTCCACCTAATCCATGGTCTAGTTCTGGCTTGTCTGGAAAATCTTCAGGGACAATGTCAGTAATCAGCAA
AGTAAATTCAGTTGGTTCCAGCTCTACAAGTTCTAGTGGACTGACTGGAAACTATGTCCCTTCCTTTCTG
AAAAAAGAAATCGGTTCTGCTATGCAGAGGGTACACCTAGCACCTATTCCAGACCCTTCCCCTGGTTATT
CCTCCCTGAAGGCCATGAGACCTCATCCTGGGCGACCATTCTTCCACACCCAGCCTAGAAGCACTCCTGG
GTTGATACCACGGCCTCCAGCCGCCCAGCCAGTGCATGGCCGGACAGACTGGGCTTCCAAGTACGCATCT
CGGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213609 representing NM_014920
Red=Cloning site Green=Tags(s)

MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIR
ENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVK
IADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIF
KICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASSEAVQLLRDMLQWDPKKRPTASQALR
YPYFQVGHPLGSTTQNLQDSEKPQKGILEKAGPPPYIKPVPPAQPPAKPHTRISSRQHQASQPPLHLTYP
YKAEVSRTDHPSHLQEDKPSPLLFPSLHNKHPQSKITAGLEHKNGEIKPKSRRRWGLISRSTKDSDDWAD
LDDLDFSPSLSRIDLKNKKRQSDDTLCRFESVLDLKPSEPVGTGNSAPTQTSYQRRDTPTLRSAAKQHYL
KHSRYLPGISIRNGILSNPGKEFIPPNPWSSSGLSGKSSGTMSVISKVNSVGSSSTSSSGLTGNYVPSFL
KKEIGSAMQRVHLAPIPDPSPGYSSLKAMRPHPGRPFFHTQPRSTPGLIPRPPAAQPVHGRTDWASKYAS
RR

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_014920
ORF Size 1896 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_014920.5
RefSeq Size 6095 bp
RefSeq ORF 1899 bp
Locus ID 22858
UniProt ID Q9UPZ9
Cytogenetics 6p12.1
Protein Families Druggable Genome, Protein Kinase
MW 71.2 kDa
Gene Summary Eukaryotic protein kinases are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. This gene encodes an intestinal serine/threonine kinase harboring a dual phosphorylation site found in mitogen-activating protein (MAP) kinases. The protein localizes to the intestinal crypt region and is thought to be important in intestinal epithelial cell proliferation and differentiation. Alternative splicing has been observed at this locus and two variants, encoding the same isoform, have been identified. [provided by RefSeq, Jul 2008]

Other Versions

Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


CILK1 rabbit polyclonal antibody
    • 25 ul

USD 800.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.