ACK1 (TNK2) (NM_005781) Human Tagged ORF Clone

CAT#: RC213566

Reviews ()
Write a review
  • TrueORF®

TNK2 (Myc-DDK-tagged)-Human tyrosine kinase, non-receptor, 2 (TNK2), transcript variant 1

  View "NM_005781" in other vectors (11)

Reward yourself with an Amazon® Card when get any 3 cDNA clones.

USD 1,090.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name ACK1 (TNK2) (NM_005781) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TNK2
Synonyms ACK; ACK-1; ACK1; p21cdc42Hs
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213566 representing NM_005781
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGCCAGAGGAGGGCACAGGCTGGCTGCTGGAGCTGCTGTCCGAGGTGCAGCTGCAACAGTACTTCC
TGCGGCTCCGAGATGACCTCAACGTCACCCGCCTGTCCCACTTTGAGTACGTCAAGAATGAGGACCTGGA
GAAGATCGGCATGGGTCGGCCTGGCCAGCGGCGGCTGTGGGAGGCTGTGAAGAGGAGGAAGGCCTTGTGC
AAACGCAAGTCGTGGATGAGTAAGGTGTTCAGTGGAAAGCGACTGGAGGCTGAGTTCCCACCTCATCACT
CTCAGAGCACCTTCCGGAAGACCTCGCCCGCCCCTGGGGGCCCAGCAGGGGAGGGGCCCCTGCAGAGCCT
CACCTGCCTCATTGGGGAGAAGGACCTGCGCCTCCTGGAGAAGCTGGGTGATGGTTCCTTTGGCGTGGTG
CGCAGGGGCGAGTGGGACGCGCCCTCAGGGAAGACGGTGAGTGTGGCTGTGAAGTGCCTGAAGCCCGATG
TCCTGAGCCAGCCAGAAGCCATGGACGACTTCATCCGGGAGGTCAATGCCATGCACTCGCTCGACCACCG
AAACCTCATCCGCCTCTACGGGGTGGTGCTCACGCCGCCCATGAAGATGGTGACAGAGCTGGCACCTCTG
GGATCGTTGTTGGACCGGCTACGTAAGCACCAGGGCCACTTCCTCCTGGGGACTCTGAGCCGCTACGCTG
TGCAGGTGGCTGAGGGCATGGGCTACCTGGAGTCCAAGCGCTTTATTCACCGTGACCTGGCTGCCCGCAA
TCTGCTGTTGGCTACCCGCGACCTGGTCAAGATCGGGGACTTTGGGCTGATGCGAGCACTACCTCAGAAT
GACGACCATTACGTCATGCAGGAACATCGCAAGGTGCCCTTCGCCTGGTGTGCCCCCGAGAGCCTGAAGA
CACGCACCTTCTCCCATGCCAGCGACACCTGGATGTTCGGGGTGACACTGTGGGAAATGTTCACCTACGG
CCAGGAGCCCTGGATCGGCCTCAACGGCAGTCAGATCCTGCATAAGATCGACAAGGAGGGGGAGCGGCTG
CCCCGGCCCGAGGACTGTCCCCAGGACATCTACAACGTCATGGTCCAGTGCTGGGCTCACAAGCCAGAGG
ACAGACCCACGTTTGTGGCCCTGCGGGACTTCCTGCTGGAGGCCCAGCCCACAGACATGCGGGCCCTTCA
GGACTTTGAGGAACCGGACAAGCTGCACATCCAGATGAATGATGTCATCACCGTCATCGAGGGAAGGGCC
GAGAACTACTGGTGGCGTGGCCAGAACACACGGACGCTGTGTGTGGGGCCCTTCCCTCGCAACGTGGTGA
CCTCCGTGGCCGGCCTGTCGGCCCAGGACATCAGCCAGCCCCTGCAGAACAGCTTCATCCACACAGGGCA
TGGCGACAGTGACCCCCGCCACTGCTGGGGCTTCCCGGACAGGATTGACGAACTGTATCTGGGAAACCCC
ATGGACCCCCCCGACCTCCTGAGCGTGGAACTGAGCACCTCCCGGCCCCCCCAGCATCTAGGAGGGGTGA
AAAAACCAACCTATGACCCTGTGAGCGAGGACCAAGACCCCTTGTCCAGCGACTTCAAGAGGCTGGGCCT
GCGGAAGCCAGGCCTGCCCCGAGGGCTGTGGCTGGCGAAGCCCTCGGCGCGGGTGCCGGGCACCAAGGCC
AGCCGAGGCAGCGGGGCTGAGGTCACGCTCATCGACTTCGGTGAGGAGCCCGTGGTCCCGGCCCTACGGC
CCTGCGCGCCCTCCCTGGCGCAGCTGGCCATGGACGCCTGCTCCCTGCTGGACGAGACCCCGCCTCAGAG
CCCCACGCGGGCACTGCCCCGGCCCCTGCACCCCACGCCTGTGGTGGACTGGGACGCACGCCCGCTGCCC
CCCCCGCCCGCCTATGACGACGTGGCCCAGGATGAGGATGACTTTGAGATCTGCTCCATCAACAGCACCC
TCGTGGGCGCGGGGGTCCCTGCCGGGCCCAGCCAGGGCCAGACCAACTACGCCTTTGTGCCTGAGCAGGC
GCGGCCGCCCCCTCCCCTGGAGGACAACCTGTTCCTCCCGCCCCAGGGTGGGGGCAAGCCGCCCAGCTCC
GCACAGACCGCAGAGATCTTCCAGGCGCTACAGCAGGAGTGCATGAGGCAACTGCAGGCTCCGGCCGGCT
CCCCGGCCCCCTCTCCCAGCCCGGGGGGTGACGACAAGCCCCAGGTGCCTCCTCGGGTACCCATCCCCCC
TCGGCCCACGCGCCCACACGTCCAGCTGTCTCCAGCCCCCCCGGGCGAGGAGGAGACCAGCCAGTGGCCT
GGACCTGCTTCCCCTCCCCGGGTGCCTCCGCGGGAGCCCCTGTCCCCTCAAGGCTCGAGGACACCCAGCC
CCCTGGTACCACCTGGCAGCTCCCCGCTGCCACCCCGGCTCTCAAGCTCACCTGGGAAGACCATGCCCAC
CACCCAGAGCTTTGCCTCAGACCCCAAGTACGCCACCCCCCAGGTGATCCAGGCCCCTGGCCCGCGGGCT
GGTCCCTGCATCCTGCCCATCGTCCGGGATGGCAAGAAGGTCAGCAGCACCCACTATTACTTGCTGCCCG
AGCGACCATCCTACCTGGAGCGCTACCAGCGCTTCCTGCGTGAGGCCCAGAGCCCCGAGGAGCCTACCCC
CCTGCCTGTGCCTCTGCTGCTGCCCCCACCCAGCACCCCAGCCCCCGCCGCCCCCACGGCCACCGTGCGG
CCGATGCCCCAGGCTGCCTTGGACCCCAAGGCCAACTTCTCCACCAACAACAGCAACCCAGGGGCCCGGC
CACCACCCCCGAGGGCCACTGCTCGGCTGCCACAGAGGGGCTGCCCTGGCGATGGGCCAGAGGCGGGCCG
GCCAGCAGACAAGATCCAGATGGCCATGGTGCATGGGGTGACCACAGAGGAGTGCCAGGCGGCCCTGCAG
TGCCACGGCTGGAGCGTGCAGAGGGCTGCCCAGTATCTGAAGGTGGAGCAGCTCTTCGGGCTGGGTCTGC
GGCCCAGAGGGGAGTGCCACAAAGTGCTGGAGATGTTCGACTGGAACCTGGAGCAGGCCGGCTGCCACCT
TCTGGGCTCCTGGGGCCCTGCCCACCACAAGCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213566 representing NM_005781
Red=Cloning site Green=Tags(s)

MQPEEGTGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALC
KRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVV
RRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPL
GSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQN
DDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWEMFTYGQEPWIGLNGSQILHKIDKEGERL
PRPEDCPQDIYNVMVQCWAHKPEDRPTFVALRDFLLEAQPTDMRALQDFEEPDKLHIQMNDVITVIEGRA
ENYWWRGQNTRTLCVGPFPRNVVTSVAGLSAQDISQPLQNSFIHTGHGDSDPRHCWGFPDRIDELYLGNP
MDPPDLLSVELSTSRPPQHLGGVKKPTYDPVSEDQDPLSSDFKRLGLRKPGLPRGLWLAKPSARVPGTKA
SRGSGAEVTLIDFGEEPVVPALRPCAPSLAQLAMDACSLLDETPPQSPTRALPRPLHPTPVVDWDARPLP
PPPAYDDVAQDEDDFEICSINSTLVGAGVPAGPSQGQTNYAFVPEQARPPPPLEDNLFLPPQGGGKPPSS
AQTAEIFQALQQECMRQLQAPAGSPAPSPSPGGDDKPQVPPRVPIPPRPTRPHVQLSPAPPGEEETSQWP
GPASPPRVPPREPLSPQGSRTPSPLVPPGSSPLPPRLSSSPGKTMPTTQSFASDPKYATPQVIQAPGPRA
GPCILPIVRDGKKVSSTHYYLLPERPSYLERYQRFLREAQSPEEPTPLPVPLLLPPPSTPAPAAPTATVR
PMPQAALDPKANFSTNNSNPGARPPPPRATARLPQRGCPGDGPEAGRPADKIQMAMVHGVTTEECQAALQ
CHGWSVQRAAQYLKVEQLFGLGLRPRGECHKVLEMFDWNLEQAGCHLLGSWGPAHHKR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005781
ORF Size 3114 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005781.2, NM_005781.3, NM_005781.4, NP_005772.3
RefSeq Size 4476
RefSeq ORF 3117
Locus ID 10188
Cytogenetics 3q29
Domains UBA, pkinase, TyrKc, SH3, S_TKc
Protein Families Druggable Genome, Protein Kinase
MW 114.4 kDa
Gene Summary This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP)-stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "TNK2"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00


Rabbit polyclonal TNK2 / ACK1 (Tyr284) antibody(Phospho-specific)
    • 100 ul

USD 335.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
BOGO Free lysates
68 Mouse Clones