CEP250 (NM_007186) Human Tagged ORF Clone

CAT#: RC213542

CEP250 (Myc-DDK-tagged)-Human centrosomal protein 250kDa (CEP250)

Change vector?

  • TrueORF®

USD 1,999


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CEP250 (NM_007186) Human Tagged ORF Clone
Symbol CEP250
Synonyms C-NAP1; CEP2; CNAP1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC213542 representing NM_007186
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGACAAGAAGCCCTGGGTTGAACAACATGAAGCCCCAGTCACTGCAGCTGGTACTGGAAGAGCAGG
TGCTGGCACTACAGCAGCAGATGGCAGAGAATCAGGCAGCCTCCTGGCGGAAGCTGAAGAACTCCCAGGA
GGCCCAGCAGAGACAAGCAACCCTTGTGAGGAAGCTGCAGGCCAAGGTGCTGCAGTACCGAAGCTGGTGC
CAAGAGCTGGAGAAGCGGCTAGAAGCCACTGGAGGACCAATCCCCCAGAGGTGGGAAAATGTGGAGGAGC
CAAACCTGGATGAGCTGCTGGTCCGATTGGAGGAGGAGCAACAGAGGTGTGAGAGTCTAGCAGAGGTGAA
CACCCAGCTTCGACTGCACATGGAAAAAGCTGACGTGGTGAATAAAGCCCTTAGGGAAGATGTGGAAAAA
CTGACAGTGGACTGGAGCCGGGCCCGGGATGAGCTAATGAGGAAGGAGAGCCAGTGGCAGATGGAGCAGG
AGTTCTTCAAGGGCTACCTGAAAGGGGAGCACGGTCGCCTTCTCAGTCTATGGCGGGAGGTTGTGACATT
CCGACGCCACTTCCTGGAAATGAAGTCAGCTACTGACAGAGATCTGATGGAGCTAAAAGCTGAGCATGTG
AGGCTTTCAGGGTCTCTGTTGACCTGTTGTCTGCGCTTGACTGTGGGAGCACAGTCTCGGGAACCCAACG
GATCTGGAAGAATGGATGGGCGGGAGCCGGCCCAGCTGCTGCTGCTACTAGCCAAGACCCAGGAGCTGGA
GAAGGAAGCCCATGAAAGGAGCCAGGAGTTAATACAGCTGAAGAGTCAAGGGGATCTGGAGAAGGCTGAA
CTTCAGGACCGGGTGACCGAGCTCTCTGCTCTGTTGACCCAGTCTCAGAAGCAAAATGAAGATTATGAAA
AGATGATAAAGGCTCTGAGAGAGACAGTGGAGATCCTGGAGACAAATCACACAGAATTAATGGAACATGA
AGCATCTCTTAGTAGGAATGCGCAAGAGGAGAAGTTGTCTTTACAGCAGGTGATCAAGGATATAACCCAG
GTCATGGTGGAAGAAGGGGACAATATAGCCCAAGGCTCTGGTCATGAGAACTCTTTGGAATTGGACTCTA
GTATCTTCTCCCAGTTTGATTACCAGGATGCAGACAAGGCTCTTACTCTGGTGCGTTCAGTGCTGACTCG
GAGACGCCAGGCTGTGCAGGACCTAAGGCAGCAGCTTGCAGGCTGTCAAGAGGCTGTGAACTTGTTGCAA
CAGCAGCATGATCAGTGGGAGGAAGAGGGCAAAGCCTTGAGACAGCGGCTGCAGAAGCTCACTGGGGAGC
GGGACACTCTGGCAGGGCAGACTGTGGACCTCCAGGGAGAGGTGGACTCTCTCAGCAAGGAGCGAGAGCT
GCTGCAGAAGGCCAGGGAAGAGCTGCGGCAGCAGCTGGAGGTGCTAGAGCAGGAGGCATGGCGCCTGCGA
AGGGTAAATGTGGAGCTTCAGCTGCAGGGGGACTCTGCCCAGGGCCAGAAGGAGGAACAGCAGGAGGAGC
TGCACCTGGCTGTCCGGGAGAGGGAGCGTCTTCAGGAGATGCTGATGGGCCTGGAAGCCAAACAGTCAGA
ATCACTCAGTGAACTGATCACTCTTCGGGAAGCCCTGGAGTCAAGTCACCTGGAAGGGGAGTTACTGAGG
CAAGAGCAAACGGAAGTGACCGCAGCGCTGGCTAGGGCAGAGCAGTCAATTGCAGAGCTGTCGAGTTCTG
AAAACACCCTGAAGACAGAAGTAGCTGATCTTCGGGCTGCAGCTGTCAAGCTCAGTGCCTTAAATGAGGC
TTTGGCGTTAGATAAAGTTGGGCTGAACCAGCAGCTTCTCCAGTTAGAGGAGGAGAACCAGTCTGTGTGC
AGCAGAATGGAGGCCGCAGAGCAGGCGAGAAATGCTTTGCAGGTCGACCTGGCGGAGGCAGAGAAGAGGA
GGGAAGCCCTGTGGGAAAAGAACACTCACCTGGAGGCTCAGCTGCAGAAAGCTGAGGAGGCTGGGGCTGA
GCTGCAGGCAGATCTCAGGGACATCCAAGAAGAGAAGGAAGAAATTCAAAAGAAACTAAGTGAGTCACGT
CACCAGCAGGAGGCAGCCACGACTCAGCTGGAGCAGCTACATCAGGAGGCAAAGCGACAGGAAGAAGTGC
TTGCCAGGGCAGTCCAGGAGAAGGAGGCCCTAGTACGAGAGAAAGCGGCTCTAGAGGTGCGGCTGCAGGC
CGTGGAGCGTGACCGGCAGGACCTCGCTGAACAACTACAGGGGCTCAGCTCAGCCAAGGAGCTACTGGAG
AGCAGTCTGTTTGAAGCCCAACAACAAAATTCTGTGATAGAGGTCACCAAGGGGCAGCTGGAGGTCCAGA
TTCAAACTGTCACTCAAGCCAAGGAAGTAATCCAAGGGGAAGTGAGGTGCCTGAAGCTGGAACTGGACAC
TGAACGGAGTCAGGCAGAGCAGGAGCGGGATGCTGCAGCCAGACAGCTGGCCCAGGCTGAGCAAGAAGGG
AAGACTGCCTTGGAGCAGCAGAAGGCAGCCCATGAGAAAGAGGTGAACCAGCTCCGGGAGAAATGGGAGA
AGGAGCGCTCCTGGCACCAGCAGGAGCTGGCAAAGGCTCTGGAGAGCTTAGAAAGGGAAAAAATGGAGCT
GGAAATGAGGCTAAAGGAGCAGCAGACAGAAATGGAGGCCATCCAGGCCCAGAGGGAAGAAGAACGGACC
CAGGCAGAGAGTGCCCTATGCCAGATGCAGCTGGAAACAGAGAAGGAGAGAGTATCCCTCCTGGAGACAC
TGCTGCAGACGCAGAAGGAGCTAGCAGATGCCAGCCAACAACTGGAACGACTGAGGCAGGACATGAAAGT
CCAGAAATTAAAGGAGCAGGAGACCACTGGGATACTACAGACCCAGCTCCAGGAGGCTCAACGGGAGCTG
AAGGAGGCAGCCCGGCAGCACAGAGATGACCTTGCTGCCCTCCAAGAAGAGAGCAGCTCCCTGCTGCAGG
ATAAGATGGACCTGCAGAAGCAGGTGGAGGACTTGAAGTCTCAGCTGGTGGCCCAGGATGACTCCCAGAG
GCTGGTGGAGCAGGAGGTTCAGGAGAAGCTGAGAGAGACCCAGGAGTATAACCGAATTCAGAAGGAGCTG
GAGAGAGAGAAAGCCAGCCTGACTCTGTCACTGATGGAAAAGGAACAGAGACTCCTTGTTTTACAAGAAG
CTGACTCTATTCGACAACAAGAGCTGAGTGCCCTGCGCCAGGACATGCAGGAGGCCCAGGGAGAACAGAA
AGAGCTCAGTGCTCAGATGGAATTACTAAGGCAAGAGGTGAAGGAAAAGGAGGCTGACTTTCTGGCCCAG
GAAGCACAGCTGCTGGAGGAGCTGGAGGCGTCTCATATCACGGAGCAGCAGCTGCGAGCCTCCTTGTGGG
CCCAGGAAGCCAAGGCAGCCCAACTACAGCTGCGACTGCGCAGCACAGAGAGCCAGCTAGAAGCGCTGGC
CGCAGAGCAGCAGCCCGGGAACCAGGCCCAGGCCCAGGCCCAGCTGGCCAGCCTCTACTCTGCCCTGCAG
CAGGCCCTGGGGTCTGTTTGTGAGAGCAGGCCTGAGCTGAGTGGTGGGGGAGACTCTGCTCCTTCCGTCT
GGGGCCTTGAGCCAGACCAGAATGGAGCTAGGAGCCTCTTTAAGAGAGGGCCCCTGCTGACTGCTCTCTC
CGCTGAGGCAGTAGCATCTGCCCTCCACAAGCTTCATCAAGACCTGTGGAAGACTCAACAGACCCGGGAT
GTTCTGAGGGATCAGGTCCAGAAACTGGAAGAGCGTCTAACTGATACTGAGGCTGAGAAGAGCCAGGTCC
ACACAGAGTTGCAGGATCTGCAGAGACAGCTCTCCCAGAATCAGGAAGAGAAATCCAAGTGGGAAGGAAA
GCAGAACTCCCTAGAATCTGAGCTGATGGAACTACATGAAACTATGGCATCCTTACAGAGTCGCCTGCGG
AGAGCAGAGCTACAGCGAATGGAAGCCCAGGGTGAGCGAGAGTTACTTCAGGCAGCCAAGGAGAACCTGA
CAGCCCAGGTGGAACACCTGCAAGCAGCTGTCGTAGAAGCCAGGGCTCAGGCAAGTGCTGCTGGCATCCT
GGAAGAAGACCTGAGAACGGCTCGCTCAGCACTGAAGCTGAAAAATGAGGAAGTAGAGAGTGAGCGTGAG
AGAGCCCAGGCTCTGCAAGAGCAGGGCGAACTGAAGGTGGCCCAAGGGAAGGCTCTGCAAGAGAATTTGG
CCCTCCTGACCCAGACCCTAGCTGAAAGAGAAGAGGAGGTGGAGACTCTGCGGGGACAAATCCAGGAACT
GGAGAAGCAACGGGAAATGCAGAAGGCTGCTTTGGAATTGCTGTCTCTGGACCTGAAGAAGAGGAACCAA
GAGGTAGATCTGCAGCAAGAACAGATTCAGGAGCTAGAGAAGTGTAGGTCTGTTTTAGAGCATCTGCCCA
TGGCCGTCCAGGAGCGAGAGCAGAAGCTGACTGTGCAGAGGGAGCAGATCAGAGAGCTCGAGAAGGATCG
GGAGACTCAGAGGAACGTCTTGGAGCATCAGCTTCTAGAACTTGAGAAGAAAGACCAAATGATTGAGTCC
CAGAGAGGACAGGTTCAGGACCTGAAAAAGCAGTTGGTTACTCTGGAATGCCTGGCCCTGGAACTGGAGG
AAAACCATCACAAGATGGAGTGCCAGCAAAAACTGATCAAGGAGCTGGAGGGCCAGAGGGAAACCCAGAG
AGTGGCTTTGACCCACCTTACGCTGGACCTAGAAGAAAGGAGCCAGGAGCTGCAGGCACAAAGCAGCCAG
ATCCATGACCTGGAGAGCCACAGCACCGTTCTGGCAAGAGAGCTGCAGGAGAGGGACCAGGAGGTGAAGT
CTCAGCGAGAACAGATCGAGGAGCTGCAGAGGCAGAAAGAGCATCTGACTCAGGATCTCGAGAGGAGAGA
CCAGGAGCTGATGCTGCAGAAGGAGAGGATTCAGGTTCTCGAGGATCAGAGGACCCGGCAGACCAAGATC
CTGGAGGAGGACCTGGAACAGATCAAGCTGTCCTTGAGAGAGCGAGGCCGGGAGCTGACCACTCAGAGGC
AGCTGATGCAGGAACGGGCAGAGGAAGGGAAGGGCCCAAGTAAAGCACAGCGCGGGAGCCTAGAGCACAT
GAAGCTGATCCTGCGTGATAAGGAGAAGGAGGTGGAATGTCAGCAGGAGCATATCCATGAACTCCAGGAG
CTCAAAGACCAGCTGGAGCAGCAGCTCCAGGGCCTGCACAGGAAGGTAGGTGAGACCAGCCTCCTCCTGT
CCCAGCGAGAGCAGGAAATAGTGGTCCTGCAGCAGCAACTGCAGGAAGCCAGGGAACAAGGGGAGCTGAA
GGAGCAGTCACTTCAGAGTCAACTGGATGAGGCCCAGAGAGCCCTAGCCCAGAGGGACCAGGAACTGGAG
GCTCTGCAGCAAGAACAGCAGCAGGCCCAGGGACAGGAGGAGAGGGTGAAGGAAAAGGCAGACGCCCTCC
AGGGAGCTCTGGAGCAAGCCCATATGACACTGAAGGAGCGTCATGGAGAGCTTCAGGACCACAAGGAACA
GGCACGAAGGCTGGAGGAAGAGCTGGCAGTGGAGGGACGGCGGGTCCAGGCCCTGGAGGAGGTGCTGGGA
GACCTAAGGGCTGAGTCTCGGGAACAGGAGAAAGCTCTGTTGGCCCTCCAGCAGCAGTGTGCTGAGCAGG
CACAGGAGCATGAGGTGGAGACCAGGGCCCTGCAGGACAGCTGGCTGCAGGCCCAGGCAGTGCTCAAGGA
ACGGGACCAGGAGCTGGAAGCTCTGCGGGCAGAAAGTCAGTCCTCCCGGCATCAGGAGGAGGCTGCCCGG
GCCCGGGCTGAGGCTCTGCAGGAGGCCCTTGGCAAGGCTCATGCTGCCCTGCAGGGGAAAGAGCAGCATC
TCCTCGAGCAGGCAGAATTGAGCCGCAGTCTGGAGGCCAGCACTGCAACCCTGCAAGCCTCCCTGGATGC
CTGCCAGGCACACAGTCGGCAGCTGGAGGAGGCTCTGAGGATACAAGAAGGTGAGATCCAGGACCAGGAT
CTCCGATACCAGGAGGATGTGCAGCAGCTGCAGCAGGCACTTGCCCAGAGGGATGAAGAGCTGAGACATC
AGCAGGAACGGGAGCAGCTGCTGGAGAAGTCTCTGGCCCAGAGGGTCCAAGAGAATATGATCCAAGAGAA
GCAGAATCTGGGGCAAGAGAGAGAAGAGGAGGAGATAAGGGGCCTTCATCAGAGTGTAAGGGAGCTACAG
CTGACTCTAGCCCAAAAGGAACAGGAGATTCTGGAGCTGAGGGAGACCCAGCAAAGGAACAACCTGGAAG
CCTTACCCCACAGCCACAAAACCTCCCCAATGGAGGAACAATCTCTAAAACTTGATTCTTTAGAGCCCAG
GCTGCAGCGGGAGCTGGAGCGGCTACAGGCAGCCCTGAGACAGACAGAAGCCAGGGAGATTGAGTGGAGG
GAGAAGGCCCAGGACTTGGCACTCTCCCTAGCGCAGACCAAGGCCAGTGTCAGCAGTCTGCAGGAGGTAG
CCATGTTCCTACAAGCCTCTGTCCTGGAGCGGGACTCAGAACAGCAAAGGCTGCAGGATGAACTGGAGCT
CACCAGACGGGCTCTGGAGAAGGAGCGGCTACACAGCCCAGGTGCAACCAGCACAGCAGAACTGGGGTCC
AGAGGGGAGCAGGGTGTGCAGCTGGGAGAGGTCTCAGGAGTGGAGGCTGAGCCTAGTCCTGATGGAATGG
AGAAGCAGTCATGGAGACAAAGGCTTGAACACCTGCAGCAAGCAGTGGCCCGGCTGGAGATTGACAGGAG
CAGGCTGCAGCGCCACAATGTCCAGCTGCGGAGTACCTTGGAGCAGGTGGAGCGAGAACGGAGGAAGCTG
AAGAGGGAGGCCATGCGTGCGGCCCAGGCAGGGTCCCTAGAGATCAGCAAGGCCACGGCTTCTTCACCCA
CACAGCAGGATGGGAGAGGACAGAAGAACTCAGATGCCAAGTGTGTGGCTGAACTGCAGAAAGAGGTGGT
CCTGCTGCAAGCTCAGCTGACTTTGGAGCGGAAGCAGAAGCAGGACTACATCACCCGCTCAGCACAGACC
AGCCGTGAGCTAGCAGGCCTGCACCACAGCCTCTCACACTCACTTCTTGCCGTGGCCCAGGCCCCTGAGG
CCACTGTCCTGGAGGCAGAGACCCGCAGGCTGGATGAGTCCCTGACTCAAAGTCTGACATCCCCAGGGCC
AGTCCTGCTACACCCCAGCCCCAGCACTACCCAAGCCGCCTCCAGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213542 representing NM_007186
Red=Cloning site Green=Tags(s)

METRSPGLNNMKPQSLQLVLEEQVLALQQQMAENQAASWRKLKNSQEAQQRQATLVRKLQAKVLQYRSWC
QELEKRLEATGGPIPQRWENVEEPNLDELLVRLEEEQQRCESLAEVNTQLRLHMEKADVVNKALREDVEK
LTVDWSRARDELMRKESQWQMEQEFFKGYLKGEHGRLLSLWREVVTFRRHFLEMKSATDRDLMELKAEHV
RLSGSLLTCCLRLTVGAQSREPNGSGRMDGREPAQLLLLLAKTQELEKEAHERSQELIQLKSQGDLEKAE
LQDRVTELSALLTQSQKQNEDYEKMIKALRETVEILETNHTELMEHEASLSRNAQEEKLSLQQVIKDITQ
VMVEEGDNIAQGSGHENSLELDSSIFSQFDYQDADKALTLVRSVLTRRRQAVQDLRQQLAGCQEAVNLLQ
QQHDQWEEEGKALRQRLQKLTGERDTLAGQTVDLQGEVDSLSKERELLQKAREELRQQLEVLEQEAWRLR
RVNVELQLQGDSAQGQKEEQQEELHLAVRERERLQEMLMGLEAKQSESLSELITLREALESSHLEGELLR
QEQTEVTAALARAEQSIAELSSSENTLKTEVADLRAAAVKLSALNEALALDKVGLNQQLLQLEEENQSVC
SRMEAAEQARNALQVDLAEAEKRREALWEKNTHLEAQLQKAEEAGAELQADLRDIQEEKEEIQKKLSESR
HQQEAATTQLEQLHQEAKRQEEVLARAVQEKEALVREKAALEVRLQAVERDRQDLAEQLQGLSSAKELLE
SSLFEAQQQNSVIEVTKGQLEVQIQTVTQAKEVIQGEVRCLKLELDTERSQAEQERDAAARQLAQAEQEG
KTALEQQKAAHEKEVNQLREKWEKERSWHQQELAKALESLEREKMELEMRLKEQQTEMEAIQAQREEERT
QAESALCQMQLETEKERVSLLETLLQTQKELADASQQLERLRQDMKVQKLKEQETTGILQTQLQEAQREL
KEAARQHRDDLAALQEESSSLLQDKMDLQKQVEDLKSQLVAQDDSQRLVEQEVQEKLRETQEYNRIQKEL
EREKASLTLSLMEKEQRLLVLQEADSIRQQELSALRQDMQEAQGEQKELSAQMELLRQEVKEKEADFLAQ
EAQLLEELEASHITEQQLRASLWAQEAKAAQLQLRLRSTESQLEALAAEQQPGNQAQAQAQLASLYSALQ
QALGSVCESRPELSGGGDSAPSVWGLEPDQNGARSLFKRGPLLTALSAEAVASALHKLHQDLWKTQQTRD
VLRDQVQKLEERLTDTEAEKSQVHTELQDLQRQLSQNQEEKSKWEGKQNSLESELMELHETMASLQSRLR
RAELQRMEAQGERELLQAAKENLTAQVEHLQAAVVEARAQASAAGILEEDLRTARSALKLKNEEVESERE
RAQALQEQGELKVAQGKALQENLALLTQTLAEREEEVETLRGQIQELEKQREMQKAALELLSLDLKKRNQ
EVDLQQEQIQELEKCRSVLEHLPMAVQEREQKLTVQREQIRELEKDRETQRNVLEHQLLELEKKDQMIES
QRGQVQDLKKQLVTLECLALELEENHHKMECQQKLIKELEGQRETQRVALTHLTLDLEERSQELQAQSSQ
IHDLESHSTVLARELQERDQEVKSQREQIEELQRQKEHLTQDLERRDQELMLQKERIQVLEDQRTRQTKI
LEEDLEQIKLSLRERGRELTTQRQLMQERAEEGKGPSKAQRGSLEHMKLILRDKEKEVECQQEHIHELQE
LKDQLEQQLQGLHRKVGETSLLLSQREQEIVVLQQQLQEAREQGELKEQSLQSQLDEAQRALAQRDQELE
ALQQEQQQAQGQEERVKEKADALQGALEQAHMTLKERHGELQDHKEQARRLEEELAVEGRRVQALEEVLG
DLRAESREQEKALLALQQQCAEQAQEHEVETRALQDSWLQAQAVLKERDQELEALRAESQSSRHQEEAAR
ARAEALQEALGKAHAALQGKEQHLLEQAELSRSLEASTATLQASLDACQAHSRQLEEALRIQEGEIQDQD
LRYQEDVQQLQQALAQRDEELRHQQEREQLLEKSLAQRVQENMIQEKQNLGQEREEEEIRGLHQSVRELQ
LTLAQKEQEILELRETQQRNNLEALPHSHKTSPMEEQSLKLDSLEPRLQRELERLQAALRQTEAREIEWR
EKAQDLALSLAQTKASVSSLQEVAMFLQASVLERDSEQQRLQDELELTRRALEKERLHSPGATSTAELGS
RGEQGVQLGEVSGVEAEPSPDGMEKQSWRQRLEHLQQAVARLEIDRSRLQRHNVQLRSTLEQVERERRKL
KREAMRAAQAGSLEISKATASSPTQQDGRGQKNSDAKCVAELQKEVVLLQAQLTLERKQKQDYITRSAQT
SRELAGLHHSLSHSLLAVAQAPEATVLEAETRRLDESLTQSLTSPGPVLLHPSPSTTQAASR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007186
ORF Size 7326 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007186.1, NM_007186.2, NM_007186.3, NM_007186.4, NM_007186.5, NP_009117
RefSeq Size 8365
RefSeq ORF 7329
Locus ID 11190
Cytogenetics 20q11.22
MW 281 kDa
Gene Summary This gene encodes a core centrosomal protein required for centriole-centriole cohesion during interphase of the cell cycle. The encoded protein dissociates from the centrosomes when parental centrioles separate at the beginning of mitosis. The protein associates with and is phosphorylated by NIMA-related kinase 2, which is also associated with the centrosome. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations