ZIP Kinase(DAPK3) (NM_001348) Human Tagged ORF Clone

CAT#: RC213427

DAPK3 (Myc-DDK-tagged)-Human death-associated protein kinase 3 (DAPK3)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 577.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ZIP Kinase(DAPK3) (NM_001348) Human Tagged ORF Clone
Symbol DAPK3
Synonyms DLK; ZIP; ZIPK
Vector pCMV6-Entry
Sequence Data
>RC213427 representing NM_001348
Red=Cloning site Blue=ORF Green=Tags(s)

CTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACGTTCAGGCAGGAGGACGTGGAGGACCATTATGAGATGGGGGAGGAGCTGGGCAGCGGCCAGT
TTGCGATCGTGCGGAAGTGCCGGCAGAAGGGCACGGGCAAGGAGTACGCAGCCAAGTTCATCAAGAAGCG
CCGCCTGTCATCCAGCCGGCGTGGGGTGAGCCGGGAGGAGATCGAGCGGGAGGTGAACATCCTGCGGGAG
ATCCGGCACCCCAACATCATCACCCTGCACGACATCTTCGAGAACAAGACGGACGTGGTCCTCATCCTGG
AGCTGGTCTCTGGCGGGGAGCTCTTTGACTTCCTGGCGGAGAAGGAGTCGCTGACGGAGGACGAGGCCAC
CCAGTTCCTCAAGCAGATCCTGGACGGCGTTCACTACCTGCACTCTAAGCGCATCGCACACTTTGACCTG
AAGCCGGAAAACATCATGCTGCTGGACAAGAACGTGCCCAACCCACGAATCAAGCTCATCGACTTCGGCA
TCGCGCACAAGATCGAGGCGGGGAACGAGTTCAAGAACATCTTCGGCACCCCGGAGTTTGTGGCCCCAGA
GATTGTGAACTATGAGCCGCTGGGCCTGGAGGCGGACATGTGGAGCATCGGTGTCATCACCTATATCCTC
CTGAGCGGTGCATCCCCGTTCCTGGGCGAGACCAAGCAGGAGACGCTCACCAACATCTCAGCCGTGAACT
ACGACTTCGACGAGGAGTACTTCAGCAACACCAGCGAGCTGGCCAAGGACTTCATTCGCCGGCTGCTCGT
CAAAGATCCCAAGCGGAGAATGACCATTGCCCAGAGCCTGGAACATTCCTGGATTAAGGCGATCCGGCGG
CGGAACGTGCGTGGTGAGGACAGCGGCCGCAAGCCCGAGCGGCGGCGCCTGAAGACCACGCGTCTGAAGG
AGTACACCATCAAGTCGCACTCCAGCTTGCCGCCCAACAACAGCTACGCCGACTTCGAGCGCTTCTCCAA
GGTGCTGGAGGAGGCGGCGGCCGCCGAGGAGGGCCTGCGCGAGCTGCAGCGCAGCCGGCGGCTCTGCCAC
GAGGACGTGGAGGCGCTGGCCGCCATCTACGAGGAGAAGGAGGCCTGGTACCGCGAGGAGAGCGACAGCC
TGGGCCAGGACCTGCGGAGGCTACGGCAGGAGCTGCTCAAGACCGAGGCGCTCAAGCGGCAGGCGCAGGA
GGAGGCCAAGGGCGCGCTGCTGGGGACCAGCGGCCTCAAGCGCCGCTTCAGCCGCCTGGAGAACCGCTAC
GAGGCGCTGGCCAAGCAAGTAGCCTCCGAGATGCGCTTCGTGCAGGACCTCGTGCGCGCCCTGGAGCAGG
AGAAGCTGCAGGGCGTGGAGTGCGGGCTGCGC


CTCGAGCAGAAACTCATCTCTGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGATGACGACG
ATAA
GGTTTAA
>RC213427 representing NM_001348
Red=Cloning site Green=Tags(s)

MSTFRQEDVEDHYEMGEELGSGQFAIVRKCRQKGTGKEYAAKFIKKRRLSSSRRGVSREEIEREVNILRE
IRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLKQILDGVHYLHSKRIAHFDL
KPENIMLLDKNVPNPRIKLIDFGIAHKIEAGNEFKNIFGTPEFVAPEIVNYEPLGLEADMWSIGVITYIL
LSGASPFLGETKQETLTNISAVNYDFDEEYFSNTSELAKDFIRRLLVKDPKRRMTIAQSLEHSWIKAIRR
RNVRGEDSGRKPERRRLKTTRLKEYTIKSHSSLPPNNSYADFERFSKVLEEAAAAEEGLRELQRSRRLCH
EDVEALAAIYEEKEAWYREESDSLGQDLRRLRQELLKTEALKRQAQEEAKGALLGTSGLKRRFSRLENRY
EALAKQVASEMRFVQDLVRALEQEKLQGVECGLR

LEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-XhoI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001348
ORF Size 1362 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001348.1, NM_001348.2, NP_001339
RefSeq Size 2105
RefSeq ORF 1365
Locus ID 1613
Cytogenetics 19p13.3
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways Pathways in cancer, Bladder cancer
MW 52.4 kDa
Gene Summary Death-associated protein kinase 3 (DAPK3) induces morphological changes in apoptosis when overexpressed in mammalian cells. These results suggest that DAPK3 may play a role in the induction of apoptosis. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)