KCNQ4 (NM_172163) Human Tagged ORF Clone

CAT#: RC213421

Reviews ()
Write a review

KCNQ4 (Myc-DDK-tagged)-Human potassium voltage-gated channel, KQT-like subfamily, member 4 (KCNQ4), transcript variant 2


  "NM_172163" in other vectors (4)

USD 98.00

USD 790.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name KCNQ4 (NM_172163) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol KCNQ4
Synonyms DFNA2; DFNA2A; KV7.4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213421 representing NM_172163
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGAGGCCCCCCCGCGCCGCCTCGGCCTGGGTCCCCCGCCCGGGGACGCCCCCCGCGCGGAGCTAG
TGGCGCTCACGGCCGTGCAGAGCGAACAGGGCGAGGCGGGCGGGGGCGGCTCCCCGCGCCGCCTCGGCCT
CCTGGGCAGCCCCCTGCCGCCGGGCGCGCCCCTCCCTGGGCCGGGCTCCGGCTCGGGCTCCGCCTGCGGC
CAGCGCTCCTCGGCCGCGCACAAGCGCTACCGCCGCCTGCAGAACTGGGTCTACAACGTGCTGGAGCGGC
CCCGCGGCTGGGCCTTCGTCTACCACGTCTTCATATTTTTGCTGGTCTTCAGCTGCCTGGTGCTGTCTGT
GCTGTCCACTATCCAGGAGCACCAGGAACTTGCCAACGAGTGTCTCCTCATCTTGGAATTCGTGATGATC
GTGGTTTTCGGCTTGGAGTACATCGTCCGGGTCTGGTCCGCCGGATGCTGCTGCCGCTACCGAGGATGGC
AGGGTCGCTTCCGCTTTGCCAGAAAGCCCTTCTGTGTCATCGACTTCATCGTGTTCGTGGCCTCGGTGGC
CGTCATCGCCGCGGGTACCCAGGGCAACATCTTCGCCACGTCCGCGCTGCGCAGCATGCGCTTCCTGCAG
ATCCTGCGCATGGTGCGCATGGACCGCCGCGGCGGCACCTGGAAGCTGCTGGGCTCAGTGGTCTACGCGC
ATAGCAAGGAGCTGATCACCGCCTGGTACATCGGGTTCCTGGTGCTCATCTTCGCCTCCTTCCTGGTCTA
CCTGGCTGAGAAGGACGCCAACTCCGACTTCTCCTCCTACGCCGACTCGCTCTGGTGGGGGACGATTACA
TTGACAACCATCGGCTATGGTGACAAGACACCGCACACATGGCTGGGCAGGGTCCTGGCTGCTGGCTTCG
CCTTACTGGGCATCTCTTTCTTTGCCCTGCCTGCCGGCATCCTAGGCTCCGGCTTTGCCCTGAAGGTCCA
GGAGCAGCACCGGCAGAAGCACTTCGAGAAGCGGAGGATGCCGGCAGCCAACCTCATCCAGGCTGCCTGG
CGCCTGTACTCCACCGATATGAGCCGGGCCTACCTGACAGCCACCTGGTACTACTATGACAGTATCCTCC
CATCCTTCAGCAGCCGGATGGGCATCAAAGACCGCATCCGCATGGGCAGCTCCCAGCGGCGGACGGGTCC
TTCCAAGCAGCATCTGGCACCTCCAACAATGCCCACCTCCCCAAGCAGCGAGCAGGTGGGTGAGGCCACC
AGCCCCACCAAGGTGCAAAAGAGCTGGAGCTTCAATGACCGCACCCGCTTCCGGGCATCTCTGAGACTCA
AACCCCGCACCTCTGCTGAGGATGCCCCCTCAGAGGAAGTAGCAGAGGAGAAGAGCTACCAGTGTGAGCT
CACGGTGGACGACATCATGCCTGCTGTGAAGACAGTCATCCGCTCCATCAGGATTCTCAAGTTCCTGGTG
GCCAAAAGGAAATTCAAGGAGACACTGCGACCGTACGACGTGAAGGACGTCATTGAGCAGTACTCAGCAG
GCCACCTGGACATGCTGGGCCGGATCAAGAGCCTGCAAACTCGGGTGGACCAAATTGTGGGTCGGGGGCC
CGGGGACAGGAAGGCCCGGGAGAAGGGCGACAAGGGGCCCTCCGACGCGGAGGTGGTGGATGAAATCAGC
ATGATGGGACGCGTGGTCAAGGTGGAGAAGCAGGTGCAGTCCATCGAGCACAAGCTGGACCTGCTGTTGG
GCTTCTATTCGCGCTGCCTGCGCTCTGGCACCTCGGCCAGCCTGGGCGCCGTGCAAGTGCCGCTGTTCGA
CCCCGACATCACCTCCGACTACCACAGCCCTGTGGACCACGAGGACATCTCCGTCTCCGCACAGACGCTC
AGCATCTCCCGCTCGGTCAGCACCAACATGGAC


ACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGA
TTACAAGGATGACGACGATAAG
GTTTAA
>RC213421 representing NM_172163
Red=Cloning site Green=Tags(s)

MAEAPPRRLGLGPPPGDAPRAELVALTAVQSEQGEAGGGGSPRRLGLLGSPLPPGAPLPGPGSGSGSACG
QRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLSTIQEHQELANECLLILEFVMI
VVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQ
ILRMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTIT
LTTIGYGDKTPHTWLGRVLAAGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAW
RLYSTDMSRAYLTATWYYYDSILPSFSSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEAT
SPTKVQKSWSFNDRTRFRASLRLKPRTSAEDAPSEEVAEEKSYQCELTVDDIMPAVKTVIRSIRILKFLV
AKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRKAREKGDKGPSDAEVVDEIS
MMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGAVQVPLFDPDITSDYHSPVDHEDISVSAQTL
SISRSVSTNMD

TRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-NotI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_172163
ORF Size 1923 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_172163.1, NM_172163.2, NP_751895.1
RefSeq Size 2173
RefSeq ORF 1926
Locus ID 9132
Cytogenetics 1p34.2
Protein Families Druggable Genome, Ion Channels: Potassium, Transmembrane
MW 71 kDa
Gene Summary The protein encoded by this gene forms a potassium channel that is thought to play a critical role in the regulation of neuronal excitability, particularly in sensory cells of the cochlea. The current generated by this channel is inhibited by M1 muscarinic acetylcholine receptors and activated by retigabine, a novel anti-convulsant drug. The encoded protein can form a homomultimeric potassium channel or possibly a heteromultimeric channel in association with the protein encoded by the KCNQ3 gene. Defects in this gene are a cause of nonsyndromic sensorineural deafness type 2 (DFNA2), an autosomal dominant form of progressive hearing loss. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Other Versions

Other products for "KCNQ4"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit Polyclonal Anti-KCNQ4 Antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools