CYP24A1 (NM_000782) Human Tagged ORF Clone

CAT#: RC213246

CYP24A1 (Myc-DDK-tagged)-Human cytochrome P450, family 24, subfamily A, polypeptide 1 (CYP24A1), nuclear gene encoding mitochondrial protein, transcript variant 1

Change vector?

  • TrueORF®

USD 660


Availability*
3 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name CYP24A1 (NM_000782) Human Tagged ORF Clone
Symbol CYP24A1
Synonyms CP24; CYP24; HCAI; P450-CC24
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC213246 representing NM_000782
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCCCCCATCAGCAAGAGCCGCTCGCTTGCCGCCTTCCTGCAGCAGCTGCGCAGTCCGAGGCAGC
CCCCGAGACTGGTGACATCTACGGCGTACACGTCCCCTCAGCCGCGAGAGGTGCCAGTCTGCCCGCTGAC
AGCTGGTGGCGAGACTCAGAACGCGGCCGCCCTGCCGGGCCCCACCAGCTGGCCACTGCTGGGCAGCCTG
CTGCAGATTCTCTGGAAAGGGGGTCTCAAGAAACAGCACGACACCCTGGTGGAGTACCACAAGAAGTATG
GCAAGATTTTCCGCATGAAGTTGGGTTCCTTTGAGTCGGTGCACCTGGGCTCGCCATGCCTGCTGGAAGC
GCTGTACCGCACCGAGAGCGCGTACCCGCAGCGGCTGGAGATCAAACCGTGGAAGGCCTATCGCGACTAC
CGCAAAGAAGGCTACGGGCTGCTGATCCTGGAAGGGGAAGACTGGCAGCGGGTCCGGAGTGCCTTTCAAA
AGAAACTAATGAAACCAGGGGAAGTGATGAAGCTGGACAACAAAATCAATGAGGTCTTGGCCGATTTTAT
GGGCAGAATAGATGAGCTCTGTGATGAAAGAGGCCACGTCGAAGACTTGTACAGCGAACTGAACAAATGG
TCGTTTGAAAGTATCTGCCTCGTGTTGTATGAGAAGAGATTTGGGCTTCTCCAGAAGAATGCAGGGGATG
AAGCTGTGAACTTCATCATGGCCATCAAAACAATGATGAGCACGTTTGGGAGGATGATGGTCACTCCAGT
CGAGCTGCACAAGAGCCTCAACACCAAGGTCTGGCAGGACCACACTCTGGCCTGGGACACCATTTTCAAA
TCAGTCAAAGCTTGTATCGACAACCGGTTAGAGAAGTATTCTCAGCAGCCTAGTGCAGATTTCCTTTGTG
ACATTTATCACCAGAATCGGCTTTCAAAGAAAGAATTGTATGCTGCTGTCACAGAGCTCCAGCTGGCTGC
GGTGGAAACGACAGCAAACAGTCTAATGTGGATTCTCTACAATTTATCCCGTAATCCCCAAGTGCAACAA
AAGCTTCTTAAGGAAATTCAAAGTGTATTACCTGAGAATCAGGTGCCACGGGCAGAAGATTTGAGGAATA
TGCCGTATTTAAAAGCCTGTCTGAAAGAATCTATGAGGCTTACGCCGAGTGTACCATTTACAACTCGGAC
TCTTGACAAGGCAACAGTTCTGGGTGAATATGCTTTACCCAAAGGAACAGTGCTCATGCTAAATACCCAG
GTGTTGGGATCCAGTGAAGACAATTTTGAAGATTCAAGTCAGTTTAGACCTGAACGTTGGCTTCAGGAGA
AGGAAAAAATTAATCCTTTTGCGCATCTTCCATTTGGCGTTGGAAAAAGAATGTGCATTGGTCGCCGATT
AGCAGAGCTTCAACTGCATTTGGCTCTTTGTTGGATTGTCCGCAAATACGACATCCAGGCCACAGACAAT
GAGCCTGTTGAGATGCTACACTCAGGCACCCTGGTGCCCAGCCGGGAACTCCCCATCGCGTTTTGCCAGC
GA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC213246 representing NM_000782
Red=Cloning site Green=Tags(s)

MSSPISKSRSLAAFLQQLRSPRQPPRLVTSTAYTSPQPREVPVCPLTAGGETQNAAALPGPTSWPLLGSL
LQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYRTESAYPQRLEIKPWKAYRDY
RKEGYGLLILEGEDWQRVRSAFQKKLMKPGEVMKLDNKINEVLADFMGRIDELCDERGHVEDLYSELNKW
SFESICLVLYEKRFGLLQKNAGDEAVNFIMAIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFK
SVKACIDNRLEKYSQQPSADFLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQ
KLLKEIQSVLPENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKEKINPFAHLPFGVGKRMCIGRRLAELQLHLALCWIVRKYDIQATDN
EPVEMLHSGTLVPSRELPIAFCQR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_000782
ORF Size 1542 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_000782.3, NM_000782.4, NP_000773
RefSeq Size 3295
RefSeq ORF 1545
Locus ID 1591
Cytogenetics 20q13.2
Protein Families Druggable Genome
MW 58.88 kDa
Gene Summary This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein initiates the degradation of 1,25-dihydroxyvitamin D3, the physiologically active form of vitamin D3, by hydroxylation of the side chain. In regulating the level of vitamin D3, this enzyme plays a role in calcium homeostasis and the vitamin D endocrine system. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations