TRPC5 (NM_012471) Human Tagged ORF Clone

CAT#: RC213238

Reviews ()
Write a review

TRPC5 (Myc-DDK-tagged)-Human transient receptor potential cation channel, subfamily C, member 5 (TRPC5)



  "NM_012471" in other vectors (6)

Reconstitution Protocol

USD 891.00


Availability*
In Stock

Size
    • 10 ug


Product images

Other products for "TRPC5"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol TRPC5
Synonyms PPP1R159; TRP5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213238 representing NM_012471
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCAACTGTACTACAAAAAGGTCAACTACTCACCGTACAGAGACCGCATCCCCCTGCAAATTGTGA
GGGCTGAGACAGAGCTCTCTGCAGAGGAGAAGGCCTTCCTCAATGCTGTGGAGAAGGGGGACTATGCCAC
TGTGAAGCAGGCCCTTCAGGAGGCTGAGATCTACTATAATGTTAACATCAACTGCATGGACCCCTTGGGC
CGGAGTGCCCTGCTCATTGCCATTGAGAACGAGAACCTGGAGATCATGGAGCTACTGCTGAACCACAGCG
TGTATGTGGGTGATGCATTGCTCTATGCCATACGCAAGGAAGTGGTGGGCGCTGTGGAGCTTCTGCTCAG
CTACAGGCGGCCCAGCGGAGAGAAGCAGGTCCCCACTCTGATGATGGACACGCAGTTCTCTGAATTCACA
CCGGACATCACTCCCATCATGCTGGCTGCCCACACCAACAACTACGAAATCATCAAATTGCTTGTCCAAA
AACGGGTCACTATCCCACGGCCCCACCAGATCCGCTGCAACTGTGTGGAGTGTGTGTCTAGTTCAGAGGT
AGACAGCCTGCGCCACTCTCGCTCCCGACTGAACATCTATAAGGCTCTGGCAAGCCCCTCACTCATTGCC
TTATCAAGTGAGGACCCCATCCTAACTGCCTTCCGTCTGGGCTGGGAGCTCAAGGAGCTCAGCAAGGTGG
AGAATGAGTTCAAGGCCGAGTATGAGGAGCTCTCTCAGCAGTGCAAGCTCTTTGCCAAAGACCTGCTGGA
CCAAGCTCGGAGCTCCAGGGAACTGGAGATCATCCTCAACCATCGAGATGACCACAGTGAAGAGCTTGAC
CCTCAGAAGTACCATGACCTGGCCAAGTTGAAGGTGGCAATCAAATACCACCAGAAAGAGTTTGTTGCTC
AGCCCAACTGCCAACAGTTGCTTGCCACCCTGTGGTATGATGGCTTCCCTGGATGGCGGCGGAAACACTG
GGTAGTCAAGCTTCTAACCTGCATGACCATTGGGTTCCTGTTTCCCATGCTGTCTATAGCCTACCTGATC
TCACCCAGGAGCAACCTTGGGCTGTTCATCAAGAAACCCTTTATCAAGTTTATCTGCCACACAGCATCCT
ATTTGACCTTCCTCTTTATGCTTCTCCTGGCTTCTCAGCACATTGTCAGGACAGACCTTCATGTACAGGG
GCCTCCCCCAACTGTCGTGGAATGGATGATATTGCCTTGGGTTCTAGGTTTCATTTGGGGTGAGATTAAG
GAAATGTGGGATGGTGGATTTACTGAATACATCCATGACTGGTGGAACCTGATGGATTTTGCAATGAACT
CCCTCTACCTGGCAACTATTTCCCTGAAGATTGTGGCCTATGTCAAGTATAATGGTTCTCGTCCAAGGGA
GGAATGGGAAATGTGGCACCCGACTCTGATTGCGGAAGCACTCTTCGCAATATCCAACATTTTAAGTTCG
TTGCGTCTCATATCCCTGTTCACAGCCAACTCCCACTTAGGACCTCTGCAGATCTCTTTGGGACGCATGC
TGCTTGATATCCTCAAATTCCTCTTTATCTACTGCCTGGTACTACTAGCTTTTGCCAATGGACTGAACCA
GCTTTACTTCTATTATGAAACCAGAGCTATCGATGAGCCTAACAACTGCAAGGGGATCCGATGTGAGAAA
CAGAACAATGCCTTCTCCACGCTCTTTGAGACTCTTCAGTCACTCTTCTGGTCTGTATTTGGCCTTTTAA
ATCTATATGTCACCAATGTGAAAGCCAGACACGAATTCACCGAGTTTGTAGGAGCTACCATGTTTGGAAC
ATACAATGTCATCTCCCTGGTAGTGCTGCTGAACATGCTGATTGCTATGATGAACAACTCCTATCAGCTT
ATTGCCGATCATGCTGATATCGAGTGGAAGTTTGCAAGGACGAAGCTCTGGATGAGTTACTTTGATGAAG
GTGGCACCTTGCCACCTCCTTTCAACATCATCCCCAGCCCCAAGTCATTTCTATACCTTGGTAACTGGTT
CAACAACACCTTCTGCCCCAAAAGAGACCCTGACGGTAGACGGAGAAGGCGCAACTTGAGAAGTTTCACA
GAACGCAATGCTGACAGCCTGATACAAAATCAACATTATCAGGAAGTTATCAGGAATTTAGTCAAAAGAT
ATGTGGCTGCTATGATAAGAAATTCCAAAACACATGAGGGACTTACAGAAGAAAATTTTAAGGAATTAAA
GCAAGACATCTCCAGCTTTCGGTATGAAGTGCTTGACCTCTTGGGAAATAGAAAACATCCAAGGAGCTTT
TCCACTAGCAGCACTGAACTGTCTCAGAGAGACGATAATAATGATGGCAGTGGTGGGGCTCGGGCCAAAT
CCAAGAGTGTCTCTTTTAATTTAGGCTGCAAGAAAAAGACTTGCCATGGGCCACCTCTCATCAGAACCAT
GCCAAGGTCCAGTGGTGCCCAAGGAAAGTCAAAAGCTGAGTCATCAAGCAAACGCTCCTTCATGGGTCCT
TCTCTCAAGAAACTGGGTCTCCTATTCTCCAAATTTAATGGTCATATGTCTGAACCCAGTTCAGAGCCAA
TGTACACAATTTCTGATGGAATTGTTCAGCAGCACTGTATGTGGCAGGACATCAGATATTCTCAGATGGA
GAAAGGGAAAGCAGAGGCCTGTTCTCAAAGTGAAATTAACCTCAGTGAGGTAGAATTAGGTGAAGTCCAG
GGCGCTGCTCAGAGCAGTGAATGCCCTCTAGCCTGTTCCAGCTCTCTTCACTGTGCATCCAGCATCTGCT
CCTCAAATTCTAAACTTTTAGACTCCTCAGAGGATGTATTTGAAACTTGGGGAGAGGCTTGTGACTTGCT
CATGCACAAATGGGGTGATGGACAGGAAGAACAAGTTACAACTCGCCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213238 representing NM_012471
Red=Cloning site Green=Tags(s)

MAQLYYKKVNYSPYRDRIPLQIVRAETELSAEEKAFLNAVEKGDYATVKQALQEAEIYYNVNINCMDPLG
RSALLIAIENENLEIMELLLNHSVYVGDALLYAIRKEVVGAVELLLSYRRPSGEKQVPTLMMDTQFSEFT
PDITPIMLAAHTNNYEIIKLLVQKRVTIPRPHQIRCNCVECVSSSEVDSLRHSRSRLNIYKALASPSLIA
LSSEDPILTAFRLGWELKELSKVENEFKAEYEELSQQCKLFAKDLLDQARSSRELEIILNHRDDHSEELD
PQKYHDLAKLKVAIKYHQKEFVAQPNCQQLLATLWYDGFPGWRRKHWVVKLLTCMTIGFLFPMLSIAYLI
SPRSNLGLFIKKPFIKFICHTASYLTFLFMLLLASQHIVRTDLHVQGPPPTVVEWMILPWVLGFIWGEIK
EMWDGGFTEYIHDWWNLMDFAMNSLYLATISLKIVAYVKYNGSRPREEWEMWHPTLIAEALFAISNILSS
LRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYYETRAIDEPNNCKGIRCEK
QNNAFSTLFETLQSLFWSVFGLLNLYVTNVKARHEFTEFVGATMFGTYNVISLVVLLNMLIAMMNNSYQL
IADHADIEWKFARTKLWMSYFDEGGTLPPPFNIIPSPKSFLYLGNWFNNTFCPKRDPDGRRRRRNLRSFT
ERNADSLIQNQHYQEVIRNLVKRYVAAMIRNSKTHEGLTEENFKELKQDISSFRYEVLDLLGNRKHPRSF
STSSTELSQRDDNNDGSGGARAKSKSVSFNLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGP
SLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEINLSEVELGEVQ
GAAQSSECPLACSSSLHCASSICSSNSKLLDSSEDVFETWGEACDLLMHKWGDGQEEQVTTRL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_012471
ORF Size 2919 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_012471.2
RefSeq Size 5839 bp
RefSeq ORF 2922 bp
Locus ID 7224
UniProt ID Q9UL62
Cytogenetics Xq23
Domains ANK, ion_trans
Protein Families Druggable Genome, Ion Channels: Transient receptor potential, Transmembrane
MW 111.2 kDa
Gene Summary This gene belongs to the transient receptor family. It encodes one of the seven mammalian TRPC (transient receptor potential channel) proteins. The encoded protein is a multi-pass membrane protein and is thought to form a receptor-activated non-selective calcium permeant cation channel. The protein is active alone or as a heteromultimeric assembly with TRPC1, TRPC3, and TRPC4. It also interacts with multiple proteins including calmodulin, CABP1, enkurin, Na(+)-H+ exchange regulatory factor (NHERF ), interferon-induced GTP-binding protein (MX1), ring finger protein 24 (RNF24), and SEC14 domain and spectrin repeat-containing protein 1 (SESTD1). [provided by RefSeq, May 2010]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.