GPR27 (NM_018971) Human Tagged ORF Clone

CAT#: RC213164

Reviews ()
Write a review
  • TrueORF®

GPR27 (Myc-DDK-tagged)-Human G protein-coupled receptor 27 (GPR27)


  "NM_018971" in other vectors (6)

USD 98.00

USD 460.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name GPR27 (NM_018971) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol GPR27
Synonyms SREB1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC213164 representing NM_018971
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGAACGCGAGCGAGCCGGGTGGCAGCGGCGGCGGCGAGGCGGCCGCCCTGGGCCTCAAGCTGGCCA
CGCTCAGCCTGCTGCTGTGCGTGAGCCTAGCGGGCAACGTGCTGTTCGCGCTGCTGATCGTGCGGGAGCG
CAGCCTGCACCGCGCCCCGTACTACCTGCTGCTCGACCTGTGCCTGGCCGACGGGCTGCGCGCGCTCGCC
TGCCTCCCGGCCGTCATGCTGGCGGCGCGGCGTGCGGCGGCCGCGGCGGGGGCGCCGCCGGGCGCGCTGG
GCTGCAAGCTGCTCGCCTTCCTGGCCGCGCTCTTCTGCTTCCACGCCGCCTTCCTGCTGCTGGGCGTGGG
CGTCACCCGCTACCTGGCCATCGCGCACCACCGCTTCTATGCAGAGCGCCTGGCCGGCTGGCCGTGCGCC
GCCATGCTGGTGTGCGCCGCCTGGGCGCTGGCGCTGGCCGCGGCCTTCCCGCCAGTGCTGGACGGCGGTG
GCGACGACGAGGACGCGCCGTGCGCCCTGGAGCAGCGGCCCGACGGCGCCCCCGGCGCGCTGGGCTTCCT
GCTGCTGCTGGCCGTGGTGGTGGGCGCCACGCACCTCGTCTACCTCCGCCTGCTCTTCTTCATCCACGAC
CGCCGCAAGATGCGGCCCGCGCGCCTGGTGCCCGCCGTCAGCCACGACTGGACCTTCCACGGCCCGGGCG
CCACCGGCCAGGCGGCCGCCAACTGGACGGCGGGCTTCGGCCGCGGGCCCACGCCGCCCGCGCTTGTGGG
CATCCGGCCCGCAGGGCCGGGCCGCGGCGCGCGCCGCCTCCTCGTGCTGGAAGAATTCAAGACGGAGAAG
AGGCTGTGCAAGATGTTCTACGCCGTCACGCTGCTCTTCCTGCTCCTCTGGGGGCCCTACGTCGTGGCCA
GCTACCTGCGGGTCCTGGTGCGGCCCGGCGCCGTCCCCCAGGCCTACCTGACGGCCTCCGTGTGGCTGAC
CTTCGCGCAGGCCGGCATCAACCCCGTCGTGTGCTTCCTCTTCAACAGGGAGCTGAGGGACTGCTTCAGG
GCCCAGTTCCCCTGCTGCCAGAGCCCCCGGACCACCCAGGCGACCCATCCCTGCGACCTGAAAGGCATTG
GTTTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213164 representing NM_018971
Red=Cloning site Green=Tags(s)

MANASEPGGSGGGEAAALGLKLATLSLLLCVSLAGNVLFALLIVRERSLHRAPYYLLLDLCLADGLRALA
CLPAVMLAARRAAAAAGAPPGALGCKLLAFLAALFCFHAAFLLLGVGVTRYLAIAHHRFYAERLAGWPCA
AMLVCAAWALALAAAFPPVLDGGGDDEDAPCALEQRPDGAPGALGFLLLLAVVVGATHLVYLRLLFFIHD
RRKMRPARLVPAVSHDWTFHGPGATGQAAANWTAGFGRGPTPPALVGIRPAGPGRGARRLLVLEEFKTEK
RLCKMFYAVTLLFLLLWGPYVVASYLRVLVRPGAVPQAYLTASVWLTFAQAGINPVVCFLFNRELRDCFR
AQFPCCQSPRTTQATHPCDLKGIGL

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_018971
ORF Size 1125 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_018971.1, NM_018971.2, NP_061844.1
RefSeq Size 1128
RefSeq ORF 1128
Locus ID 2850
Cytogenetics 3p13
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
MW 39.6 kDa
Gene Summary GPR27 is a member of the G protein-coupled receptors (GPCRs), a large family of receptors that have a similar structure characterized by 7 transmembrane domains. Activation of GPCRs by extracellular stimuli such as neurotransmitters, hormones, or light induces an intracellular signaling cascade mediated by heterotrimeric GTP-binding proteins, or G proteins. [supplied by OMIM, May 2010]

Other Versions

Other products for "GPR27"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Rabbit polyclonal anti-GPR27 antibody
    • 100 ul

USD 345.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools