MLKL (NM_152649) Human Tagged ORF Clone

CAT#: RC213152

Reviews ()
Write a review
  • TrueORF®

MLKL (Myc-DDK-tagged)-Human mixed lineage kinase domain-like (MLKL), transcript variant 1



  "NM_152649" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 477.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MLKL
Synonyms hMLKL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213152 representing NM_152649
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAATTTGAAGCATATTATCACCCTTGGCCAGGTCATCCACAAACGGTGTGAAGAGATGAAATACT
GCAAGAAACAGTGCCGGCGCCTGGGCCACCGCGTCCTCGGCCTGATCAAGCCTCTGGAGATGCTCCAGGA
CCAAGGAAAGAGGAGCGTGCCCTCTGAGAAGTTAACCACAGCCATGAACCGCTTCAAGGCTGCCCTGGAG
GAGGCTAATGGGGAGATAGAAAAGTTCAGCAATAGATCCAATATCTGCAGGTTTCTAACAGCAAGCCAGG
ACAAAATACTCTTCAAGGACGTGAACAGGAAGCTGAGTGATGTCTGGAAGGAGCTCTCGCTGTTACTTCA
GGTTGAGCAACGCATGCCTGTTTCACCCATAAGCCAAGGAGCGTCCTGGGCACAGGAAGATCAGCAGGAT
GCAGACGAAGACAGGCGAGCTTTCCAGATGCTAAGAAGAGATAATGAAAAAATAGAAGCTTCACTGAGAC
GATTAGAAATCAACATGAAAGAAATCAAGGAAACTTTGAGGCAGTATTTACCACCAAAATGCATGCAGGA
GATCCCGCAAGAGCAAATCAAGGAGATCAAGAAGGAGCAGCTTTCAGGATCCCCGTGGATTCTGCTAAGG
GAAAATGAAGTCAGCACACTTTATAAAGGAGAATACCACAGAGCTCCAGTGGCCATAAAAGTATTCAAAA
AACTCCAGGCTGGCAGCATTGCAATAGTGAGGCAGACTTTCAATAAGGAGATCAAAACCATGAAGAAATT
CGAATCTCCCAACATCCTGCGTATATTTGGGATTTGCATTGATGAAACAGTGACTCCGCCTCAATTCTCC
ATTGTCATGGAGTACTGTGAACTCGGGACCCTGAGGGAGCTGTTGGATAGGGAAAAAGACCTCACACTTG
GCAAGCGCATGGTCCTAGTCCTGGGGGCAGCCCGAGGCCTATACCGGCTACACCATTCAGAAGCACCTGA
ACTCCACGGAAAAATCAGAAGCTCAAACTTCCTGGTAACTCAAGGCTACCAAGTGAAGCTTGCAGGATTT
GAGTTGAGGAAAACACAGACTTCCATGAGTTTGGGAACTACGAGAGAAAAGACAGACAGAGTCAAATCTA
CAGCATATCTCTCACCTCAGGAACTGGAAGATGTATTTTATCAATATGATGTAAAGTCTGAAATATACAG
CTTTGGAATCGTCCTCTGGGAAATCGCCACTGGAGATATCCCGTTTCAAGGCTGTAATTCTGAGAAGATC
CGCAAGCTGGTGGCTGTGAAGCGGCAGCAGGAGCCACTGGGTGAAGACTGCCCTTCAGAGCTGCGGGAGA
TCATTGATGAGTGCCGGGCCCATGATCCCTCTGTGCGGCCCTCTGTGGATGAAATCTTAAAGAAACTCTC
CACCTTTTCTAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213152 representing NM_152649
Red=Cloning site Green=Tags(s)

MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTTAMNRFKAALE
EANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQRMPVSPISQGASWAQEDQQD
ADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYLPPKCMQEIPQEQIKEIKKEQLSGSPWILLR
ENEVSTLYKGEYHRAPVAIKVFKKLQAGSIAIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFS
IVMEYCELGTLRELLDREKDLTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGF
ELRKTQTSMSLGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_152649
ORF Size 1413 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_152649.4
RefSeq Size 2496 bp
RefSeq ORF 1416 bp
Locus ID 197259
UniProt ID Q8NB16
Cytogenetics 16q23.1
Domains pkinase
Protein Families Druggable Genome, Protein Kinase
MW 54.3 kDa
Gene Summary This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to be inactive because it lacks several residues required for activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (RIP3), which is a key signaling molecule in necroptosis pathway. Inhibitor studies and knockdown of this gene inhibited TNF-induced necrosis. High levels of this protein and RIP3 are associated with inflammatory bowel disease in children. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Sep 2015]

Other Versions

Other products for "MLKL"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


MLKL rabbit polyclonal antibody
    • 25 ul

USD 800.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.