BRF1 (NM_001519) Human Tagged ORF Clone

CAT#: RC213148

Reviews ()
Write a review

BRF1 (Myc-DDK-tagged)-Human BRF1 homolog, subunit of RNA polymerase III transcription initiation factor IIIB (S. cerevisiae) (BRF1), transcript variant 1



  "NM_001519" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 691.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol BRF1
Synonyms BRF; BRF-1; CFDS; GTF3B; hBRF; HEL-S-76p; TAF3B2; TAF3C; TAFIII90; TF3B90; TFIIIB90
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC213148 representing NM_001519
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGGGCCGCGTGTGCCGCGGTTGCGGCGGCACGGACATCGAGCTGGACGCGGCGCGCGGGGACGCGG
TGTGCACCGCCTGCGGCTCAGTGCTGGAGGACAACATCATCGTGTCCGAGGTGCAGTTCGTGGAGAGCAG
CGGCGGCGGCTCCTCGGCCGTGGGCCAGTTCGTGTCCCTGGACGGTGCTGGCAAAACCCCGACTCTGGGT
GGCGGCTTCCACGTGAATCTGGGGAAGGAGTCGAGAGCGCAGACCCTGCAGAATGGGAGGCGCCACATCC
ACCACCTGGGGAACCAGCTGCAGCTGAACCAGCACTGCCTGGACACCGCCTTCAACTTCTTCAAGATGGC
CGTGAGCAGGCACCTGACCCGCGGCCGGAAGATGGCCCACGTGATTGCTGCCTGCCTCTACCTGGTCTGC
CGTACGGAGGGCACGCCGCACATGCTCCTGGACCTCAGCGACCTGCTCCAGGTGAATGTGTACGTGCTTG
GAAAGACGTTTCTTCTCTTGGCAAGAGAGCTCTGCATCAATGCGCCGGCCATAGACCCGTGCCTGTATAT
TCCACGCTTTGCGCACCTGCTGGAATTCGGGGAGAAGAACCACGAGGTGTCCATGACTGCCCTGAGGCTC
CTACAGAGGATGAAGCGGGACTGGATGCACACAGGCCGGCGCCCCTCGGGCCTCTGCGGAGCAGCGCTCC
TGGTTGCAGCCAGAATGCATGACTTCAGGAGGACTGTGAAGGAGGTCATCAGTGTGGTCAAAGTGTGTGA
GTCCACGCTGCGGAAGAGGCTCACGGAATTTGAAGACACCCCCACCAGTCAGTTGACCATTGATGAGTTC
ATGAAGATCGACCTGGAGGAGGAGTGCGACCCCCCCTCGTACACAGCTGGGCAGAGGAAGCTGCGGATGA
AGCAGCTTGAACAAGTCCTGTCAAAAAAACTGGAGGAGGTTGAAGGTGAAATATCCAGTTACCAGGATGC
AATTGAGATTGAACTAGAAAACAGCCGGCCAAAGGCCAAGGGGGGCCTGGCCAGCCTGGCAAAAGATGGC
TCCACCGAGGACACCGCGTCCAGCTTGTGTGGCGAGGAGGACACAGAGGACGAGGAGCTGGAAGCCGCGG
CCAGCCACCTGAACAAAGACTTATACCGGGAGCTCCTTGGTGGTGCCCCCGGCAGCTCGGAAGCAGCAGG
AAGCCCCGAGTGGGGCGGCAGACCTCCGGCCCTGGGGTCCCTGCTGGACCCCCTCCCCACTGCAGCCAGC
CTGGGCATCTCAGACTCCATCCGCGAATGCATCTCCTCTCAGAGCAGCGACCCCAAAGATGCTTCAGGAG
ACGGTGAGCTGGACCTCAGTGGCATTGATGACCTGGAGATTGACAGGTACATCCTGAATGAGTCGGAAGC
CCGCGTGAAGGCCGAGCTGTGGATGAGGGAGAACGCCGAGTACCTGCGGGAACAGAGGGAAAAAGAAGCA
AGAATAGCGAAAGAGAAGGAGCTCGGCATCTACAAGGAACACAAGCCCAAGAAGTCTTGCAAGCGACGGG
AGCCAATTCAGGCCAGTACCGCCAGGGAGGCCATCGAGAAGATGCTGGAGCAGAAGAAGATCTCCAGCAA
GATCAATTATAGCGTGCTCCGGGGCCTCAGCAGCGCCGGCGGGGGCAGTCCGCACAGGGAGGATGCACAG
CCCGAGCATAGCGCCAGTGCCAGGAAGCTGTCACGAAGGAGGACGCCGGCCAGCAGAAGTGGGGCTGACC
CTGTGACCAGTGTGGGGAAAAGGTTGAGGCCTCTGGTGTCTACGCAGCCAGCAAAGAAGGTGGCCACGGG
AGAGGCTTTGCTCCCAAGCTCTCCCACCCTCGGAGCTGAGCCTGCCAGGCCCCAGGCGGTGCTGGTGGAG
AGCGGGCCCGTGTCATACCACGCCGACGAGGAGGCTGACGAGGAGGAGCCTGACGAGGAGGACGGGGAGC
CCTGCGTCAGTGCCCTGCAGATGATGGGCAGCAACGACTATGGCTGTGATGGCGATGAGGACGACGGCTA
C


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC213148 representing NM_001519
Red=Cloning site Green=Tags(s)

MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSLDGAGKTPTLG
GGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSRHLTRGRKMAHVIAACLYLVC
RTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPAIDPCLYIPRFAHLLEFGEKNHEVSMTALRL
LQRMKRDWMHTGRRPSGLCGAALLVAARMHDFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEF
MKIDLEEECDPPSYTAGQRKLRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDG
STEDTASSLCGEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEA
RIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINYSVLRGLSSAGGGSPHREDAQ
PEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQPAKKVATGEALLPSSPTLGAEPARPQAVLVE
SGPVSYHADEEADEEEPDEEDGEPCVSALQMMGSNDYGCDGDEDDGY

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001519
ORF Size 2031 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001519.4
RefSeq Size 3660 bp
RefSeq ORF 2034 bp
Locus ID 2972
UniProt ID Q92994
Cytogenetics 14q32.33
Domains transcript_fac2, CYCLIN
Protein Families Transcription Factors
MW 73.7 kDa
Gene Summary This gene encodes one of the three subunits of the RNA polymerase III transcription factor complex. This complex plays a central role in transcription initiation by RNA polymerase III on genes encoding tRNA, 5S rRNA, and other small structural RNAs. The gene product belongs to the TF2B family. Several alternatively spliced variants encoding different isoforms, that function at different promoters transcribed by RNA polymerase III, have been identified. [provided by RefSeq, Jun 2011]

Other Versions

Other products for "BRF1"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


BRF1 rabbit polyclonal antibody
    • 25 ul

USD 800.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.